KEGG   Jatropha curcas: 105640347Help
Entry
105640347         CDS       T03922                                 

Definition
(RefSeq) probable apyrase 7
  KO
K01510  apyrase [EC:3.6.1.5]
Organism
jcu  Jatropha curcas
Pathway
jcu00230  Purine metabolism
jcu00240  Pyrimidine metabolism
jcu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    105640347
   00240 Pyrimidine metabolism
    105640347
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:jcu04090]
    105640347
Enzymes [BR:jcu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.5  apyrase
     105640347
CD molecules [BR:jcu04090]
 Proteins
  105640347
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDA1_CD39 Ppx-GppA
Motif
Other DBs
NCBI-GeneID: 105640347
NCBI-ProteinID: XP_012080019
UniProt: A0A067KFM7
Position
Unknown
AA seq 560 aa AA seqDB search
MESKSPSKVKLPIMGFARYKRVLRICAAIVVILLLLVAGYFAFEYRRPRDLAKRDYFTVV
VDCGSTGTRVNVYKWKIRSSSCNWDLPILEHTYPDNSTESLFSGSSCKYHCMQTEPGLDK
FAGNSTGVRVSLEPLILWAEQWVPRDRHGDTPIFVLATAGLRKLPVEDVRLVLDDVESIL
KERSFVYRRSWIRVLSGKEEAYYGWVALNYKMGKLGNSSQGSTLGLLDLGGSSLQVVMEV
HGEERDNIHLIRTKIGSVERQILAHSLQSFGLNEAFDGTVAKLSQLQLIIGSNDEISKVR
HPCLGSDFMQNYTCNACNGHNISHRKNMSGQMHKSEYTSLVGDPDWEQCIRIARAAAINS
SSSDTSHPTVSNNCKASLSFNSGSGFLNLTAGAYPTRRFHALSGFFAVTNILDLGPRANL
TKIWEKGEQLCSKSSGELSKISEKQNYFRQYCFRLPYMASLIEDALCLGNKEIIFGPGDL
SWTLGAALVEGEYLWLSTSKTSISSLTSMEVIYSPIFVSLLLLFLLFIAYHSQIKLPMIG
KKGPAITSLPSYLYPKHRPN
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atggaatccaaatcaccttcaaaagttaagctgccaattatgggtttcgctaggtataaa
cgggttttgagaatatgtgcagctattgtagtgattttgctgttattggttgctggttat
tttgcatttgagtataggagacctcgtgatttagcaaaaagagattatttcactgttgtt
gtggattgtggaagcactggaacgcgagtgaatgtctataagtggaaaattagaagttca
tcatgtaactgggatttgcctattttggagcatacttaccctgataattcaactgagagt
ttgttttctggaagttcttgtaaatatcattgtatgcagacagagccaggtttagataag
tttgctggtaattctacaggagtgagagtatcattggaaccattgatcttgtgggcggaa
cagtgggtgcctcgtgacagacatggagacactcccatttttgtcctagctactgctgga
ctcaggaagttgccagttgaggatgttaggctggttttggatgatgtggagagtattctg
aaggaacgctcgtttgtttataggagaagttggataagagttttgagtgggaaagaagag
gcttattatggttgggtggctttgaactataagatggggaagttagggaattcatcgcaa
ggatccacattaggtctactagatctgggaggttcatcgttgcaggttgttatggaagtt
catggtgaggaaagagataatatccatttgataagaacaaagattggttcagtcgaacgt
cagattttagcacactcgttgcaatcatttggcttgaatgaggcatttgatgggacagtt
gccaagctcagtcagttgcagctgattataggaagcaatgatgaaatatctaaagtcagg
catccttgtctaggttctgatttcatgcaaaattacacttgcaatgcttgtaatgggcat
aatattagtcaccggaagaatatgagtggtcaaatgcacaagagtgaatatacttctttg
gttggagacccagattgggagcaatgcataagaattgccagggctgcggctattaactcg
agcagttcagatacgtcacatccaacagttagcaataattgcaaagcaagcctctccttt
aacagcggcagtggctttcttaatttgacagctggtgcctacccaaccagacgctttcat
gctctctctggttttttcgctgttaccaacatattagatctgggtccaagagcaaatttg
accaagatttgggagaaaggtgagcagctgtgttcaaaatcaagtggtgagttgagcaag
atttctgaaaaacaaaattactttagacagtactgtttccggctgccttatatggcatcc
ctcattgaagatgctttgtgtcttggcaataaggaaataatttttggtcctggagatctt
tcttggacattaggagctgcactggttgaaggggaatacctctggctgagcacttctaaa
acaagcatttcatccctaacaagcatggaggtcatatattctcccatttttgtttccctt
ttacttctctttcttttatttattgcttaccatagtcaaatcaagctgcctatgatagga
aaaaagggtcctgccattacatctttaccatcttacctttatcccaaacaccgaccaaac
taa

DBGET integrated database retrieval system