KEGG   Jatropha curcas: 105640368Help
Entry
105640368         CDS       T03922                                 

Definition
(RefSeq) uncharacterized protein LOC105640368
  KO
K06195  ApaG protein
Organism
jcu  Jatropha curcas
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    105640368
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF525 UVR DUF4354 CBM49
Motif
Other DBs
NCBI-GeneID: 105640368
NCBI-ProteinID: XP_012080047
UniProt: A0A067KFP9
Position
Unknown
AA seq 289 aa AA seqDB search
MHSLSSIKVLTDFRASPRLPVRSSCFERKAWLNFGDSARTCRIVACSVERNGNGGGGTSS
SSSSGSGLGSDHSASSFLSRTQTYALLKQQMEVAAQSEDYEEAARLRDSLKSFEEGEPVL
LLRRMLKEAISDERFEDAARYRDELKEIAPHSLLKCSSDATTLGIRVQVRSVYIDGRSQP
SKGQYFFAYRIRITNNSDRPVQLLRRHWIITDANGKTENVWGVGVIGEQPVILPKTGFEY
SSACPLTTPDGRMEGDFEMKHIDTVGSPTFNVAIAPFSLSILGDESDTF
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcattcgctttctagtattaaagtgcttaccgatttccgcgcaagtccgcgcttgccg
gttcgtagctcctgtttcgagaggaaggcgtggctaaattttggggattccgcgaggaca
tgtcgtattgtagcgtgttccgtggagagaaacggaaatggcggtggaggaacaagttcg
agctcaagttctgggtcgggtttgggttcggatcatagtgcaagttcgtttttgtcgcgg
actcaaacttatgctttgttgaagcagcaaatggaagttgctgcccaatctgaggattac
gaagaagctgctagacttcgtgattcattgaaatcgtttgaggaaggggaaccagttctg
ctacttcgtaggatgcttaaggaggccatcagtgacgaacgatttgaggatgctgctaga
tatcgtgatgaactgaaagaaatcgccccacattcgctcctgaaatgttcgagtgatgca
acaaccttggggatcagggttcaagttaggagcgtgtacattgacggcagaagtcagcct
tctaagggacagtacttctttgcgtacagaataagaatcactaataactcagatcgtcct
gttcaactgctcagaagacattggattatcactgatgccaatggaaaaactgagaatgtc
tggggtgttggagttataggtgaacagccagttatacttcctaagacagggtttgaatac
tcatctgcttgcccattaactactcctgatggcagaatggaaggtgactttgagatgaaa
catattgatacggtaggctcaccaactttcaatgtggctattgcaccattttctctctca
atactaggagacgaaagtgacactttttga

DBGET integrated database retrieval system