KEGG   Jatropha curcas: 105641861Help
Entry
105641861         CDS       T03922                                 

Definition
(RefSeq) probable methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
jcu  Jatropha curcas
Pathway
jcu00670  One carbon pool by folate
jcu01100  Metabolic pathways
jcu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    105641861
Enzymes [BR:jcu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     105641861
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-GeneID: 105641861
NCBI-ProteinID: XP_012081878
UniProt: A0A067KCG2
Position
Unknown
AA seq 602 aa AA seqDB search
MKVIDKINAAQAVANGGGEANNRVVFSFEFFPPKTEDGVDNLFDRMDRMVAHNPSFCDIT
WGAGGSTADLTLDIANKMQNMICVETMMHLTCTNMPVEKIDHALQTIKSNGIQNVLALRG
DPPHGQDKFVQVEGGFACALDLVKHIRSKYGDYFGITVAGYPEAHPDMIGSDGLATPENY
QKDLEYLKRKVDAGADLIVTQLFYDTDVFLKFVNDCRQIGINCPIVPGIMPINNYKGFIR
MTGFCKTKIPAEVTAALEPIKDNEEAVRAYGIHLGTEMCKKILAHGIKTLHLYTLNMEKS
ALAILLNLGLIEESKIRRPLPWRPPTNVFRVKEDVRPIFWANRPKSYIARTLGWEQYPHG
RWGDSNNPSYGALTDYQFMRPRARDKKLHDEWAVPLNSIEDICEKFKKFCLGKMKSSPWS
ELDGLQPETKIINEQLGKINMKGFLTINSQPAVNGEKSDSLTVGWGGPGGYVYQKAYLEF
FCSPIKLQDLVNKSKAWPQLTYMAVDRAGTVVSNVGPNDVNAVTWGVFPAKQIIQPTVVD
PASFNVWKDEAFEIWSRGWASLYPEGDPSRKLLEEVQDNYFLVSLVDNDYIHGDIFAIFA
DL
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcatagacaaaattaatgccgcacaagctgttgcaaatggaggaggagaagct
aacaatagagtcgttttctccttcgaattcttccctcccaaaacggaagatggtgttgat
aaccttttcgatagaatggaccgtatggtcgctcacaatccatctttttgcgacattaca
tggggagctggtggctctactgcagatctgactcttgatatcgctaataagatgcagaat
atgatctgtgttgagactatgatgcatctcacttgcactaacatgcctgttgagaagatc
gaccatgctcttcaaactatcaaatctaatggtatccagaatgttcttgctcttcgcggt
gatcctcctcatggtcaggataagttcgtccaagtggaaggtggatttgcttgtgcgctt
gatctggtgaaacatatcagatctaaatatggtgactactttggcattactgttgccggt
tatccagaggcgcaccctgatatgattggaagtgatgggttggctacaccagagaattac
caaaaagatctagagtatttgaagagaaaggttgatgctggagctgatttgattgtaaca
caactattctatgatactgatgtttttctcaagtttgtgaatgattgccgtcaaattgga
ataaattgtccaattgttcctggaattatgcctattaataactacaagggcttcataaga
atgactggcttttgcaaaacaaagataccagctgaggttactgctgcattggagcctatc
aaagacaatgaagaagcagtcagagcatatggaattcaccttggaacagaaatgtgcaag
aagattttagctcatggcattaagacgttgcacctttacacattaaacatggagaaatct
gcattggcaatattactgaatcttggtttgattgaggagtccaagattagaaggccatta
ccgtggcgaccgccaacaaacgttttccgtgtgaaggaagatgtgcgtccaatattttgg
gctaatcgtcccaagagctacatagctagaaccttgggctgggagcagtacccacacggt
cggtggggtgattctaataatccatcctatggtgctttaactgactatcagttcatgcga
ccacgtgcacgtgacaagaaacttcatgatgaatgggctgttcccttgaatagtattgaa
gatatttgtgagaaattcaaaaaattctgccttgggaagatgaaaagcagtccgtggtca
gaactagatggccttcaaccagagacaaagattattaatgaacagctgggcaagatcaat
atgaagggattcttgactatcaatagtcaaccagcagtcaatggagaaaaatctgattcc
ctaactgttggttggggaggaccaggaggatatgtttatcagaaagcttatttggagttt
ttctgctccccgatcaagctacaagatcttgttaacaagtccaaagcttggcctcaattg
acttacatggctgtggacagggcaggaactgtggtatccaacgtcggtccaaatgatgtg
aatgcagtgacatggggagtcttcccagcaaagcagattatccaacccactgttgttgat
ccggccagcttcaatgtatggaaggatgaggcatttgaaatctggtctagaggatgggct
tcattatacccagagggtgatccatccagaaagttgcttgaagaggtgcaggacaactac
tttttggttagcttggtagataatgattatatccatggcgatatttttgcaatttttgca
gatttatga

DBGET integrated database retrieval system