KEGG   Jatropha curcas: 105643657Help
Entry
105643657         CDS       T03922                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: probable terpene synthase 3
  KO
K15803  (-)-germacrene D synthase [EC:4.2.3.75]
Organism
jcu  Jatropha curcas
Pathway
jcu00909  Sesquiterpenoid and triterpenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    105643657
Enzymes [BR:jcu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.75  (-)-germacrene D synthase
     105643657
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Terpene_synth_C ANTAR ASL_C SAM_4 ADSL_C
Motif
Other DBs
NCBI-GeneID: 105643657
NCBI-ProteinID: XP_020538738
Position
Unknown
AA seq 201 aa AA seqDB search
MAMVCVMDDIYDVHGTIEELELFTKVKKQVGAYITEARXFNNHYVPTFEEYIMLXLVXXX
XXXXXXXXXXXXXXXXXXXXFTEPKLLYTASGLARLINDIMSHEFEQERGHVASAVECCM
KQYGVSKQEAYEKLNKIVANMWKDLNEELMKEIDIPKPILMCILNIVRVMDVVYKDEDSY
THSNTSLKDILATFLVNPVAV
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggctatggtgtgtgtaatggatgatatctatgatgtgcatggcacaattgaggaactt
gagcttttcaccaaagtgaagaagcaagttggagcctacataactgaagcaagatgattc
aacaatcattatgtgccaacatttgaagaatatataatgctgtgattagttannnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnna
ttcactgaacctaaacttctatatactgcatcaggtctcgcaaggctcatcaatgacatt
atgtcccatgagtttgagcaagaaaggggacatgttgcttctgcagtagaatgttgtatg
aagcaatatggtgtgtcaaagcaggaagcttacgaaaagctgaataaaatagttgctaat
atgtggaaagatctgaacgaggagctgatgaaagaaattgatattccaaaacctattcta
atgtgcattctgaacattgtacgtgtaatggatgttgtgtacaaggatgaagatagctat
acccactccaacacttctctgaaggatattctggctacctttttagtcaatcctgtggct
gtttaa

DBGET integrated database retrieval system