KEGG   Jatropha curcas: 105644464Help
Entry
105644464         CDS       T03922                                 

Definition
(RefSeq) tyrosine decarboxylase 1 isoform X1
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
jcu  Jatropha curcas
Pathway
jcu00350  Tyrosine metabolism
jcu00360  Phenylalanine metabolism
jcu00380  Tryptophan metabolism
jcu00950  Isoquinoline alkaloid biosynthesis
jcu00965  Betalain biosynthesis
jcu01100  Metabolic pathways
jcu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    105644464
   00360 Phenylalanine metabolism
    105644464
   00380 Tryptophan metabolism
    105644464
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    105644464
   00950 Isoquinoline alkaloid biosynthesis
    105644464
   00965 Betalain biosynthesis
    105644464
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:jcu04147]
    105644464
Enzymes [BR:jcu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     105644464
    4.1.1.105  L-tryptophan decarboxylase
     105644464
Exosome [BR:jcu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105644464
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 105644464
NCBI-ProteinID: XP_012085210
Position
Unknown
AA seq 492 aa AA seqDB search
MYREGELRPMDAEQLREYAHKMVDFIADYYKTIENFPVLSQVEPGYLRKVLPESAPNRPG
SLQNILDDVQAKILPGVTHWQSPNYFAYYPSNSSVAGFLGEMLSAGINMVGFSWITSPAA
TELEMIVLDWLGKMLKLPEYFFSTGQGGGVIQGTASEALLVVMLAARDKVLRRVGKDALG
KLVVYGSDQTHSSLQKACQIAGVHPENCRLLKTDSSTNYALAPDLLYEAISNDISIGLIP
FFLCATVGTTSSTAVDPLLALGKIAENNGMWLHVDAAYAGSACICPEYRRYIDGVEKADS
FNMNAHKWFLTNFDCSALWVKDRNALIQSLSTNPEFLKNNLSEANKVVDYKDWQIPLGRR
FRSLKLWMVLQLYGVENLQCYIRNHINLAKYFEGLVAEDTRFEIVAPRTFSLVCFRLLPP
RNNEDRGNKLNHELLDAVNSTGRTFISHTVLSGKYTLRFAVGAPLTEERHVTAAWKVLQE
KASALLGITRAS
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgtatagggaaggagagctgagaccaatggatgcagagcaacttagagagtatgctcat
aaaatggttgattttattgctgattattataaaaccatagagaattttccagttcttagc
caagttgagcctgggtatcttcgtaaagtacttccagaatctgcacctaatcgacccggg
tcattgcaaaatattcttgacgatgtccaagcaaagattttgccaggagtgacccattgg
caaagcccaaattattttgcatattatccttctaacagcagtgttgctggatttttggga
gaaatgcttagcgccggtatcaatatggtgggctttagctggataacttcccctgctgca
acagagcttgaaatgattgttctagactggcttggtaaaatgttaaaattacctgaatat
tttttctcgacaggacaaggaggtggagtgattcagggtactgcaagtgaagctctacta
gttgtaatgctagctgctcgagacaaggtcttgaggagggtgggaaaagatgccttggga
aagcttgtggtttatggatctgatcaaacacattcgtctttgcaaaaagcttgtcagata
gctggggttcatccagaaaattgcaggctgctaaaaacggactcttccacaaactatgct
cttgcaccagatttactttatgaagcaatttcaaatgacatttcaattggattgattccc
ttcttcttatgtgccactgttggcactacttcatcaacagctgttgatcccttacttgca
ctgggaaagatcgctgagaataatggaatgtggcttcatgtggatgctgcctatgctgga
agtgcgtgtatatgtccagaataccgacgttacattgatggtgttgaaaaagctgactct
tttaacatgaatgcgcataaatggttcttaacaaactttgattgctcagccctttgggtg
aaggatagaaatgctcttattcagtcactttctacaaatccagagtttctgaaaaacaat
ctgtccgaagcaaacaaggttgtagattacaaggattggcaaattcctcttgggcgtcgg
tttaggtcattgaaactgtggatggtattacaattatatggtgtggaaaacctccaatgc
tacatcagaaatcatattaatttggccaaatattttgaaggacttgttgctgaagacact
aggtttgagattgttgcccctcgaacattttcattggtttgttttcgtcttttacctccc
cgtaacaatgaagaccgcggcaacaaactgaaccatgaactattagatgcagtaaactca
acagggaggacttttatatctcatacagttttatccggcaaatatacattgcgttttgcg
gtaggagcaccattgactgaagaaagacatgtaacagcagcatggaaggtcttgcaagag
aaggcctctgctttgctagggattacaagggcgagttga

DBGET integrated database retrieval system