KEGG   Jatropha curcas: 105645759Help
Entry
105645759         CDS       T03922                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1 isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
jcu  Jatropha curcas
Pathway
jcu00010  Glycolysis / Gluconeogenesis
jcu00562  Inositol phosphate metabolism
jcu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105645759
   00562 Inositol phosphate metabolism
    105645759
Enzymes [BR:jcu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     105645759
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     105645759
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 GCP_N_terminal
Motif
Other DBs
NCBI-GeneID: 105645759
NCBI-ProteinID: XP_012086835
Position
Unknown
AA seq 498 aa AA seqDB search
MKAAMASISSFLSLFSLSILTLSIADQSFDVRQHLSTVTRYGAVKDLPSPSESSHIATGC
TPIHLNLVARHGTRSPTAKRMRELDRLASHLEELIRDANERNLSLQKLPTWLQSWTSPWK
GKLKGGQLISKGEDELYDLGLRTRERFPDLFNEEYHPDVYTIKATQVPRASASAVAFGMG
LFSGKGSLGPGRHRAFAVITESRASDIMLRFHDCCENYKAYRKGQEPAVEKLKEPVLNEI
TASLVSRYELNFTRKDTASLWFLCKQEASLLDITDQACSLFSHSEVALLEWTDDLELFIL
KGYGKSINYRMGVPLLRDVVQSMEQAIKAQEENNAPGSYEKARLRFAHAETVVPFTCLLG
LFLEGSEFQKIQREQPLELPPRPPQSRNWWGSLVAPFTGNNMLVLHSCPANSSNKYFVQV
LHNEHPIPMPGCNNSDVCPFEEFKEKIAAPHLKHDYNAVCSLKLEEPEQKSETSKLSLLF
RWLFSLGREGTQSTKTEL
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcggccatggcttccatttcttcgttcctttcccttttctctttatcaattctg
acgctttccatagccgatcaaagcttcgatgtacgccaacacctctccactgtaacaaga
tatggtgcagttaaagatttgccttccccctctgaaagttctcatattgctacgggatgc
actcctatccacttaaacctcgtggcaagacatggaactcgttctcctactgcaaaacgg
atgagagagctggatcgattggcatctcacttggaagaacttataagagatgccaatgag
cggaatttatcattgcagaaacttccgacctggttacaaagttggacttctccttggaaa
gggaaattgaaaggtggacaattgattagcaaaggagaagatgaattgtatgatcttgga
ctaaggactagggaaagatttccagatttattcaatgaggaatatcaccctgatgtgtac
acaataaaggctacccaggttcctcgggcatcagctagtgctgtggcatttggcatgggg
ctgtttagtgggaagggaagtcttggaccagggcgtcatcgggcttttgctgtcatcact
gaaagccgtgctagtgatatcatgcttaggtttcatgattgttgtgaaaactacaaggct
tataggaaaggtcaggagccagctgttgagaagcttaaggaacctgttttaaacgaaatt
acagcttcattagtcagccgttatgaacttaattttacaagaaaggacaccgcttctctc
tggtttctttgtaaacaggaagcgtccttgttggatataacagatcaagcttgcagcctt
ttcagccattctgaggtggccttgctggagtggacagatgacttggagttgtttatattg
aagggttatggtaaatcaataaactatcgaatgggggtgccattgcttcgagatgttgtt
caatctatggagcaagccattaaggcacaagaagaaaacaatgcacctggaagttatgaa
aaggcaagactgcggtttgcacatgcggagactgttgttccttttacatgtctgcttggt
cttttccttgaaggatcagagttccaaaaaatacaaagagaacaacctttggaacttccc
ccgcggcctccccagagcagaaattggtggggcagtttagtggcaccttttactgggaac
aacatgctggtcctgcacagttgtccagcaaactcttcaaacaagtactttgtccaagtg
ctccacaatgaacatcccattccgatgccgggttgcaataattctgatgtatgtccattt
gaagagtttaaggaaaagatcgctgctcctcatttaaagcacgactataatgcagtctgc
agtctgaagctggaagaaccagagcagaagtctgaaaccagtaagttatcactactgttc
cgttggcttttctcgctggggagagaaggtacacagtctacaaaaactgaattgtaa

DBGET integrated database retrieval system