KEGG   Jatropha curcas: 105646481Help
Entry
105646481         CDS       T03922                                 

Definition
(RefSeq) receptor-like protein kinase FERONIA
Organism
jcu  Jatropha curcas
SSDB OrthologParalogGFIT
Motif
Pfam: Malectin_like Pkinase_Tyr Pkinase Malectin Kinase-like
Motif
Other DBs
NCBI-GeneID: 105646481
NCBI-ProteinID: XP_020539930
Position
Unknown
AA seq 763 aa AA seqDB search
MGFIIASLFSLFSISLILTKLISLASLFIILLPCITAVHSLPPYTPPDIILLNCGESSLT
TSPDGRNWVSDARSKFGASTSQNSSFAFKASRQDTSVTQVPYMTARIFLSKFTYSFPVSL
GSKFVRLYFYPVAYSNLDISKSFFSVEANDYTLLSNFSAFLTVSAMQPPAAAIVKEFVVT
IQEKQMLNVTFNPSLKSFAFINGIEIISMPEGLYIHGNDSPLVNVGIDYPFYLDNKTALE
TVYRLNVGGRDIDSSGDTGMYRKWVQDSNYIFGAAFGVTSISKVKINYTKITPAWVAPEL
VYSTMRSMGSQRKVNIKYNLTWIFPVDTGFNYLVRLHFCETRLEVTGALQLVFSIFINNQ
TAVAQADVIYWSGGRGVPVYKDHVIWIPAAGPGKQDLWLALHPSDEFELADATLNGLEIF
KLNKSKGSLAGPNSEPILVQTPPVRQPKLLERTKSKHVKKVTILIGLVFGGVLLLAFILC
FFVFNQRRRGNPDEGEMILIYDYLINGTLGEHLHETNNDPLPWKKRLHICIGAARGLHYL
HSEFTHTIIHRDVKTTNILLDENWIAKVSDFGLSKAAFKQEVSTTIVKGTWGYLDPEYAR
YQILTEKSDVYSFGVVLFEVLCALKPLDRNLVEEHMNLAIWAEKCIQNGNIYQIIDPYLK
GKIAPRCFKKFVEIAFSCVHSKGIERPNMRDVMEELEFALKLQDDAEAENMGISPDGEIV
HPYVSFFPAQCVDIADGPQLDSTSSTDSDTSSSTTGVFGSRIG
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atgggcttcataattgcctcacttttttctttgttctctatctctcttatcttgacaaaa
ttaatttctcttgcatctctcttcataatccttctcccttgcatcacagccgttcacagc
ttgccgccatatactccaccagacattatccttctcaactgtggtgagtcctctctcaca
acatcacccgacggccgaaattgggttagcgatgcccgatccaaattcggtgcctctacc
tctcagaactcatcatttgctttcaaagcctcccgacaagatacatctgtgacccaagtc
ccttacatgacagctcgtatttttctatccaaattcacctacagctttcctgtctcactt
ggctcaaaatttgttcgtctctacttctatcctgttgcttactccaatcttgatatctcc
aaatccttcttctccgttgaagccaatgactacacacttctaagcaactttagcgctttt
cttacggtttcagccatgcagcctccagctgctgccattgtgaaagagtttgtcgttact
attcaggaaaaacagatgcttaacgtaacttttaatccatctctgaaatcttttgccttc
ataaacggtattgaaatcatctcaatgccagagggtctttatatacacggaaatgatagc
ccgctggtaaatgttggcattgactatcccttctatttggataataaaacagctcttgag
actgtttatcggttaaatgttggaggacgggatattgacagttcaggtgacaccggaatg
tacaggaaatgggttcaagactctaattatatttttggtgctgcatttggagtgacgtct
atttctaaggttaagataaattatacaaagattactccggcttgggttgctcctgaattg
gtatatagtactatgcgttcaatgggttctcaacgaaaagtcaacattaaatacaatctc
acttggatattccccgttgatactggattcaactatcttgttcgtctccacttttgtgag
actcgactagaggttaccggtgcgcttcaactggtattctcgatattcatcaataatcaa
acagcggtagctcaagcagatgtaatatactggagcggtggtagaggtgttccagtgtac
aaagaccacgtcatatggattccagcagcaggccccggcaagcaggacttgtggctcgct
ttacacccatctgatgagtttgagttagctgacgcgaccttgaacggtttggagatattc
aagttgaataaatcaaagggtagtttagcagggccaaactctgaaccaatactagttcag
acaccaccagtccggcaaccaaaactattagaaagaacaaaaagcaaacacgtaaagaaa
gtaacaattttaattggactagtatttggtggtgtcttattgcttgcttttattctttgt
ttctttgtttttaatcagaggaggagaggaaatcctgatgaaggtgaaatgattctcatc
tatgattaccttatcaacggcacacttggagaacatttacatgaaacaaacaatgatcct
cttccgtggaaaaaaaggcttcacatatgcataggtgcagcacgcggattgcattatctt
cattccgagttcacgcataccattatccatcgagacgtgaagacaactaatattttgcta
gacgaaaactggattgcaaaagtttcagatttcggattatccaaagcagctttcaaacag
gaggtcagtactactatagtgaagggaacttggggttatttagatccagaatatgcaaga
taccaaatattaacagaaaaatctgatgtgtactcatttggtgtagtattatttgaagtc
ttgtgtgctctgaagccgcttgatcgaaatttggtggaagaacatatgaacttagccatc
tgggctgaaaaatgcattcaaaatggaaacatttatcaaataattgatccttatttgaag
gggaagatagctccacggtgtttcaaaaaatttgtggagatcgcattcagttgcgttcat
agcaaaggcattgaacggcccaatatgagagatgttatggaagaacttgagtttgcactg
aagctgcaagacgatgcggaagctgagaatatgggaatcagtcctgatggtgaaatcgtc
catccttatgtatcttttttccctgcccaatgtgttgatattgccgacggacctcagcta
gactcaacttcatcaactgattctgatacaagtagttcaactacgggtgtgtttggctca
aggattggctga

DBGET integrated database retrieval system