KEGG   Jatropha curcas: 105647837Help
Entry
105647837         CDS       T03922                                 

Definition
(RefSeq) probable LRR receptor-like serine/threonine-protein kinase RKF3
Organism
jcu  Jatropha curcas
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH PTP_tm
Motif
Other DBs
NCBI-GeneID: 105647837
NCBI-ProteinID: XP_012089454
UniProt: A0A067JHZ1
Position
Unknown
AA seq 637 aa AA seqDB search
MSLFPFPFFLLLLVLTFSNLSSSSAATFPKISNKNLTGTADELSDSSCPLNFNVLRELAD
EAPLKLALIDVPRQCTYIRKGLLFVRSEYLRTNGFFFPPPDTLEACWNSYGKLVAEYLHG
FDAQATCGYHPEWISETYMNITTKAQFEALIPTTELQEMTDYCNRSLDNTSSCKSCTQKL
SSIEKLYLQVSPYDDDLTEDASDYLFMYAAAFSNKLGPGDSATAKCLFTLEFSWRLTSDR
KRKSVISGVVLGCIIGVFGAAVSVWLFWILHKKYGKKKMRSSVDYKDHESSLEFGLGKLY
RRSANLVKFRIDEIRAATMNFSRNYLIGKGGYGNVYKGTLPDGSQVAFKRFKSCSASCDA
TFAHEVEIIASVRHVNLVALRGYCTATVPMEGHQRIIVCDLMHNGSLYDHLFLSEENNKL
SWPIRQKIALGTARGLAYLHYGVHPAIIHRDIKASNILLDDTFEPKVADFGLARFNSQGL
THLSTRAAGTLGYVAPEYALYGKLTERSDVYSYGVVLLELLSGKKAYETNPDGEVSLLTD
WAWSLVKQGRALDVIEENIPELGCREVMEQYVFIAVICAHPILSARPTMYQIVKILESNL
HLAPFSLEAYPIGSNNSTVSSVSSNCITCSSITATDP
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgtctctctttcccttccctttctttcttttactattagtcttaacattttccaattta
tcttcttcatcagctgcaactttccccaaaatctcaaacaaaaaccttactggtactgct
gatgaattatcagactcctcttgtccactgaacttcaatgttcttcgtgaactagccgat
gaagcccctttaaagcttgctctaattgatgttccaaggcaatgcacatatattcgaaaa
gggctcctttttgttcgatcagaatatcttcgaacaaatgggttcttttttcctcctcca
gacactttagaggcttgttggaactcatatgggaagttagtagcagaatacttgcatggt
tttgatgctcaagctacttgtggatatcatcctgaatggatttcagagacttatatgaat
attacaactaaagcacaatttgaagccctaattcccacaacggaattgcaagaaatgaca
gattattgtaacagatctttggataatacctcttcttgtaaatcttgcactcaaaagttg
tcaagtattgaaaaactgtaccttcaggttagtccttatgatgatgatctaactgaggat
gcttctgattatttgttcatgtatgcagctgcttttagcaataaacttggaccgggcgat
tcagcaactgcaaaatgcttattcacgcttgaattttcttggcggttaacttctgatagg
aaacgcaaatctgtgatttcaggtgttgttttaggttgcatcattggagtttttggtgct
gctgtttcagtttggttgttttggatattgcataagaaatatggaaagaaaaaaatgaga
agttctgttgattataaagatcatgagagtagtttggaattcggattgggaaaactatat
aggagaagtgctaatttagtgaaatttagaatagatgaaattagggctgccacaatgaac
ttctcaagaaattatctaattggaaaaggaggatatggaaatgtttacaaaggaacatta
ccggatggttctcaagttgcattcaaaagattcaagagctgttcagcttcttgtgatgca
acatttgcacatgaagtagaaatcattgcaagtgttagacatgtcaatcttgttgcttta
agaggctattgcactgcaacagttccaatggaaggtcatcagagaattattgtatgtgat
ttgatgcataatgggtctctttacgatcatttattcttatcagaagagaataacaagctt
agctggcctattcgacagaaaatcgcgcttggaacagctcgcggattagcttatttacac
tatggagtacatcctgctataatacatagagatataaaagctagtaatatacttcttgat
gatacattcgaaccaaaagttgcagatttcggcctggcaagattcaattctcaaggattg
acacatttaagtacaagagctgcaggtactcttggctatgttgctcctgaatatgcccta
tatgggaaattaacagaaagaagtgatgtttatagctatggagttgtacttcttgaactt
ttgagtggaaaaaaagcatatgaaactaatcctgatggagaagtttctcttctgacagat
tgggcttggtctttggttaaacaaggtagagcattggatgttatagaggagaatatacct
gaattgggttgcagagaagttatggagcagtatgtttttattgctgttatttgtgctcat
ccaatactgtctgcaaggccaacaatgtatcagattgtcaaaatactggagtctaatctg
cacttagctcccttttctcttgaagcttatcctattggtagtaataacagtacagttagc
agtgtcagctcaaattgtataacctgttcttccattacagcaaccgatccatga

DBGET integrated database retrieval system