KEGG   Jatropha curcas: 105647891Help
Entry
105647891         CDS       T03922                                 

Definition
(RefSeq) methionine--tRNA ligase, chloroplastic/mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
jcu  Jatropha curcas
Pathway
jcu00450  Selenocompound metabolism
jcu00970  Aminoacyl-tRNA biosynthesis
jcu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    105647891
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    105647891
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:jcu01007]
    105647891
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:jcu03016]
    105647891
Enzymes [BR:jcu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     105647891
Amino acid related enzymes [BR:jcu01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   105647891
Transfer RNA biogenesis [BR:jcu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    105647891
 Prokaryotic type
   Other AARSs
    105647891
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-GeneID: 105647891
NCBI-ProteinID: XP_012089507
UniProt: A0A067L949
Position
Unknown
AA seq 610 aa AA seqDB search
MAARINQSLLTPLYSITRRSRTNTHVQTRISFPPNLFLSSSKSRKAAFCTYSISNDNRKN
DEAGTAETFVLTTPLYYVNAPPHMGSAYTTIAADAIARFQRLLGKKVIFVTGTDEHGEKI
ATAAAACGASPSEHCDVISQAYKTLWKDLEIAYDKFIRTTDPKHEAIVKEFYSRVLANGD
IYRADYEGLYCVNCEEYKDEKDLLDNKCCPVHLKPCIQRKEDNYFFALSKYQKLLEETLT
ECPNFVQPSFRLNEVQSWIRSGLKDFSISRASVDWGIPVPNDNKQTIYVWFDALLGYISA
LSEDNKQPNLQSAVSSGWPASLHLIGKDILRFHAVYWPAMLMSAGLGLPKMVFGHGFLTK
DGLKMGKSLGNTLEPNELIEKFGPDAVRYFFLREVEFGSDGDYSEERFVNIVNAHLANTI
GNLLNRTLGLLKKNCQSTLVVDAAIAAEGNAFKDNVEKLVEKARIHYENLSLSLACEAVL
EIGNAGNGYMDERTPWSLFKKGGAASEAAAKDLVIILEAMRIIAIALSPVAPSLSWRIYA
QLGYSQDHFNSITWSETKWGGLKGGQVMAQPKPVFARIENKTETEDGEATSKKSVKNKEK
KPRAQVVAEA
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgagaataaaccagtcgctcttaacccctttatattctattactagaaggtca
agaacaaatacccatgtccagactcgtattagtttccctccaaatctcttcctttcttct
tctaaatcaagaaaggctgcgttttgcacttatagtattagcaatgacaatcgtaaaaac
gacgaagcagggacagctgaaacatttgtcctcacaactccgctttattacgtgaatgcc
cctcctcatatgggtagtgcctataccaccatcgctgctgatgccatagctcgatttcag
agacttttagggaagaaagttatatttgttactggcactgatgagcatggagagaagatt
gctactgctgcagctgcctgtggcgctagcccaagtgagcactgtgatgtcatatcacaa
gcttacaagacactttggaaagatttagaaattgcttatgacaaatttattcggacaact
gatcccaagcatgaagcaattgtcaaggaattttattctagagttcttgccaatggggat
atttatcgcgctgactatgagggactatactgtgtcaactgtgaggagtataaggatgag
aaggatctgcttgataacaagtgttgtcccgtgcacctaaagccatgcattcagcggaaa
gaggataattatttctttgccttgtcaaagtaccaaaagctattagaagaaacattgaca
gagtgtccaaattttgtgcagccttcattccgtttgaatgaggtgcaaagctggattaga
agtggcttgaaagatttttcaatttcccgagcatcagtggattggggcattccagttcct
aatgacaataagcagaccatatatgtttggttcgatgcattactaggctacatatcagct
ctatcggaggacaacaaacaacctaatttacaaagtgctgtttcttctggttggcctgct
tcactacatttgattgggaaggatattttacgtttccatgcagtttattggccagctatg
ctaatgtctgctggtctaggtcttcctaagatggtgtttggacatggattcttgacaaag
gatggcctgaagatgggaaagtcattggggaatacacttgaaccaaatgagttgattgag
aaatttgggcctgatgcagtcaggtactttttcctcagagaggtggagtttggcagtgat
ggggactactcagaagagcgttttgttaacattgtcaatgcacaccttgccaatactatt
ggaaaccttcttaaccgcactcttggacttcttaaaaagaattgtcaatcaactttggtg
gttgatgcagctattgcagctgaaggaaatgcattcaaggacaatgttgaaaagttggtt
gaaaaggctcggattcattatgaaaatctctctttgtcattggcttgtgaggctgttctt
gagattggtaatgctggaaatggctacatggatgaacgcactccatggtctctttttaag
aaagggggtgctgcttctgaagctgctgcaaaggatctggtgattatattggaagcaatg
agaattatagcgattgctttatcccctgttgcgccaagtttatcctggagaatttatgca
cagcttggctactcacaggaccatttcaacagtataacatggagtgagaccaagtgggga
gggctgaagggtggtcaggtcatggctcaacctaaaccagtctttgcaaggattgagaac
aaaacagaaacagaagatggtgaagcaacaagtaagaagtctgtgaaaaacaaggaaaaa
aaacctcgagctcaagttgttgcagaagcttag

DBGET integrated database retrieval system