KEGG   Jatropha curcas: 105648604Help
Entry
105648604         CDS       T03922                                 

Definition
(RefSeq) acid beta-fructofuranosidase 1, vacuolar
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
jcu  Jatropha curcas
Pathway
jcu00052  Galactose metabolism
jcu00500  Starch and sucrose metabolism
jcu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    105648604
   00500 Starch and sucrose metabolism
    105648604
Enzymes [BR:jcu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     105648604
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357
Motif
Other DBs
NCBI-GeneID: 105648604
NCBI-ProteinID: XP_012090431
UniProt: A0A067JHY9
Position
Unknown
AA seq 627 aa AA seqDB search
MDYSSYTPLPDHPTGNKRRPTLKVLSAVFASLIFLLSLVTLIINQSQLEPNENHLPPTTK
PTSFSNPEPRGVAEGVSAKSNPSSFNNGVSYNWTNAMFSWQRTAFHFQPQQNWMNDPDGP
LFHLGWYHLFYQYNPDSAVWGNITWGHAVSKDLIHWLYLPLAMVPDKWYDINGMWTGSAT
LLPDGQIMMLYTGDTNASVQVQNLAYPANLSDPLLLDWVKYPGNPVIIPPPGIEISEFRD
PTTGWLGPDGKWRIAIGSRVNKTIGVSLVYQTTNFTTYEKLEGVLHAVPGTGMWECVDFY
PVAINGSVGLDTSANGLGTKHVLKASLDNTKVDHYALGTYDPITDTWTPDNPKEDVGIGL
RVDYGRYYASKTFYDQHKERRILWGWINETDTEEDDLDKGWASVQTIPRAVLFDNKTGTN
LLQWPVEEIESLRLNSTDFEEIVVGPGSIVPLEIGVATQLDIFAEFETELISNSVVEEYG
CNGGAVNRSSLGPFGLLVLADETLSELTPVFFRPVNSTDGSFKTYFCSDEKRSSKAPDVC
KQVYGSTVPVLDDEKLRMRVLVDHSIVESFAQGGRTVITSRIYPTEAIDGNARLFLFNNA
TSVNVKATLKIWELMPAFIRPFPLDDN
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atggactattcctcctatactcccttgccggaccatccgaccggtaataaacgccggccg
accttgaaggttctatctgcagtattcgcttctctgatttttctgctttcattagtcaca
ttaatcattaaccaaagtcaattagagccaaacgagaaccacttacctccaacaactaaa
cctacttcgttttcgaatccggagccaagaggcgtggctgaaggagtatcagccaagtca
aatccgtcgtctttcaacaatggagtttcctacaattggaccaacgccatgttttcttgg
caaagaacagcttttcactttcaacctcagcaaaactggatgaacgatcctgatggtcca
ttgtttcacctgggttggtaccacctattttaccaatataaccccgattcagctgtctgg
ggcaacatcacgtggggccatgctgtatcgaaggacttgatccattggctctatctccca
cttgcgatggtccctgataagtggtatgatataaatggaatgtggactggatccgctacg
cttcttccagatggtcaaatcatgatgctttatactggagacaccaatgcttcagtgcag
gtgcaaaatctcgcttatcccgccaacctatctgatcctctcctccttgactgggtcaaa
tatccaggaaatccagttattattcccccacccggaatcgaaatcagtgaatttagagac
ccaacgacgggatggctgggacccgatggtaagtggaggattgcaatcgggtcaagggtt
aataagacaattggcgtttcacttgtctaccaaaccaccaattttacgacctatgagaag
ttggaaggagtcttgcatgcagttccgggcacgggtatgtgggaatgcgtggacttttac
ccggtggcaataaacggttctgttggattagatacatccgctaatgggctgggtacaaag
catgtattaaaggcaagtttagataatacgaaagtagatcattacgcacttggaacctat
gacccaataacagacacatggacacccgataacccgaaagaggatgtgggtatcgggtta
cgtgtggattatggaagatactatgcgtcaaagacgttttatgaccagcacaaggagaga
agaatcttatggggttggatcaatgaaactgatactgaagaagatgacttggataaaggc
tgggcctctgttcagacaattccaagggctgtactatttgataacaagactggaaccaat
ttgctccaatggcctgtggaggagatcgagagcttaagattaaacagtactgattttgaa
gaaattgtggttggacccggctcgatagtcccgcttgaaataggcgtggcgacgcagcta
gacatatttgcagaatttgaaacggaattaatatcaaattctgtagttgaagaatacgga
tgcaatggtggtgcagttaacagaagctctttgggaccatttggccttctagttcttgca
gacgaaacactttctgaattgactcctgtttttttccgtcccgttaattcaaccgatggg
agtttcaaaacttatttttgttctgatgaaaaaagatcgtcaaaggctcctgatgtctgt
aagcaagtttatggaagcaccgttccagtgctcgacgatgaaaagctgaggatgagagtg
ttggttgatcattccatagtggagagttttgcacaaggaggaaggacagtcatcacgtcc
agaatttacccgacagaagcaatcgatggaaatgcaaggctgtttctgttcaacaatgca
acttctgtgaatgttaaggcaacgctcaaaatatgggaattaatgcctgcctttatccgc
ccttttcctctcgacgacaattaa

DBGET integrated database retrieval system