KEGG   Jatropha curcas: 105649482Help
Entry
105649482         CDS       T03922                                 

Definition
(RefSeq) internal alternative NAD(P)H-ubiquinone oxidoreductase A2, mitochondrial
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
jcu  Jatropha curcas
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    105649482
Enzymes [BR:jcu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     105649482
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox
Motif
Other DBs
NCBI-GeneID: 105649482
NCBI-ProteinID: XP_012091526
UniProt: A0A067JLL5
Position
Unknown
AA seq 540 aa AA seqDB search
MAFSRIARTGLRRAEGTFSSYASEGVLVHRWSSPSLRNVIAGSHLSYLSTFSTVNHASFW
NRGIRVTPNYQFPNAERILDESENEYDERRYPGLEATKPGEKPRVVVLGTGWAACRFMKG
LDTKIYDVVCISPRNHMVFTPLLASTCVGTLEFRSVAEPVSRIQSALATSPNSYFYLASC
IGVDTDKHEVFCETVSNGGLPQEPYRFKVAYDKLVIAAGAEPLTFGIKGVKEHAFFLREV
NHAQEIRKKLLLNLMLSENPGISEEEKSRLLHCVVIGGGPTGVEFSGELSDFIMRDVQER
FAHVKDHIKVTLIEANEILSSFDVGLRQYATNHLTKCGVCLTKGVVKEVHSRKLVLSDGT
EVPYGLLVWSTGVGPSEFVKSLNLPKSPGGRIGIDQWLRVPAVEDVFALGDCAGFLEQTG
RPVLPALAQVAERQGKYLVQLFNNIGRQNGGKAFSAKEVPLGDPFVYKHMGSMASVGRYK
ALVDLRQSKDAKGLSLAGFLSWLIWRSAYLTRVVSWRNRFYVAVNWATTLVFGRDNSRIG
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atggcgttttcaagaattgctaggactggcttgagaagagcagaaggcaccttcagtagt
tatgcaagtgaaggagtattagttcatagatggtcttcaccttcccttagaaatgtcatt
gcagggagccatttgtcgtacctttccaccttcagcacagtaaatcatgcaagtttttgg
aacaggggaataagggtaaccccaaactaccaatttcctaatgcagagaggattttggac
gagtctgaaaatgagtatgatgaaagaaggtatccaggtctagaagcaaccaaacctggt
gaaaagccaagagtggttgtacttggcactggatgggcagcatgtcgattcatgaaagga
cttgacaccaaaatatatgatgttgtttgcatatcaccaaggaatcacatggtcttcact
cctttgcttgcttcaacttgtgttggaacccttgaatttcgctctgtagctgagcctgtt
agtcggatacaatctgcattggcaacaagtcctaattcgtacttttatctggcttcctgc
atcggtgttgacacggacaaacatgaagtgttctgtgagacagttagcaatggtggatta
cctcaggagccttaccggtttaaagttgcatatgacaagcttgttattgctgctggagct
gagcctttgacttttggtatcaagggagttaaggaacacgcatttttcctaagagaagta
aatcatgctcaagaaataaggaagaagctcctcttgaatcttatgctttctgaaaatcca
ggcatatctgaagaagagaagagccgcctcttacactgtgtggttattggaggtggtcct
acaggagtggaatttagtggtgaattgagtgattttatcatgagagatgttcaagaacgg
tttgctcatgttaaggatcacattaaggtcactcttatagaggccaatgagattctatca
tcatttgatgttggactgcgacaatatgcaacaaatcatttgacaaagtgtggtgtttgt
ctcacgaaaggcgtagtgaaagaggtgcattccaggaaattagtactcagtgatggtact
gaagttccatatggtctactggtatggtccactggtgttggtccatctgagtttgttaag
tcactaaatcttcccaagtctcctggtggaaggattggtattgatcaatggttgcgggta
cctgcagtagaagatgtgtttgcacttggagattgtgctggttttcttgaacagacaggg
aggccagtgcttccagctttggctcaggttgcagaaaggcaagggaaatatctagtgcag
ttgtttaacaacattggaaggcaaaatggaggaaaggctttcagtgcaaaagaggtccct
ctaggcgacccttttgtgtataagcacatgggtagcatggcatcagttgggcgttacaag
gcccttgttgatttgcgccagtctaaggatgcaaaaggattatcacttgcaggatttctt
agctggctaatctggcgttctgcttatcttacacgtgtggtcagttggaggaacagattt
tacgtggctgtaaactgggcaaccaccttggtttttggcagagacaactcgaggatagga
tag

DBGET integrated database retrieval system