KEGG   Jatropha curcas: 105649757Help
Entry
105649757         CDS       T03922                                 

Definition
(RefSeq) uncharacterized protein LOC105649757 isoform X1
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
jcu  Jatropha curcas
Pathway
jcu00790  Folate biosynthesis
jcu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    105649757
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:jcu04147]
    105649757
Enzymes [BR:jcu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     105649757
Exosome [BR:jcu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105649757
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pterin_4a IF-2
Motif
Other DBs
NCBI-GeneID: 105649757
NCBI-ProteinID: XP_012091911
UniProt: A0A067JEP7
Position
Unknown
AA seq 187 aa AA seqDB search
MNRWLLPSLHFLSKSQVPLASLFEGFLNGHGRSSTQVKQIHWYHVRMSSNRNSFNGFRTY
CSGRDLAAKKCVPCNSKDIRAMTEESANEMMPKVAGWNLVNEDGTLKLNRSWKVKSFTKG
LELFQLVGNVAEAEDHHPDLHLVGWNNVKIEIWTHSVGGLTENDFILAAKINGLELHHLL
RKKKAAT
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaatcggtggttgctgccatcactgcacttcctctctaaatctcaggtgccactagca
tctctattcgaaggatttttgaacggacatggacgctccagtactcaagttaaacaaata
cactggtatcatgtgaggatgtcatccaataggaactcatttaatggatttaggacttac
tgctctggcagagatctagctgctaagaagtgtgtaccatgcaactcaaaggatatccga
gccatgacagaagaaagtgcaaatgaaatgatgccaaaggttgccgggtggaatttggtg
aatgaagatggtacactgaagctgaatcggtcatggaaagtaaagagtttcaccaaaggg
ttggagttattccagcttgttggcaatgttgctgaagctgaagatcatcatccagatctt
catcttgttggatggaacaatgtaaaaattgagatatggactcattcagttggtggacta
acagaaaatgacttcatacttgctgctaaaatcaatgggcttgagctgcaccacctgcta
agaaaaaaaaaggctgctacttga

DBGET integrated database retrieval system