KEGG   Jatropha curcas: 105650953Help
Entry
105650953         CDS       T03922                                 

Definition
(RefSeq) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
jcu  Jatropha curcas
Pathway
jcu00670  One carbon pool by folate
jcu01100  Metabolic pathways
jcu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    105650953
Enzymes [BR:jcu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     105650953
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FTHFS CbiA
Motif
Other DBs
NCBI-GeneID: 105650953
NCBI-ProteinID: XP_012093309
UniProt: A0A067LJ73
Position
Unknown
AA seq 634 aa AA seqDB search
MSTSRRKLQVVSPVPADIDIANSVEPFHISEIAKDLNLSPNHYDLYGKYKAKVLLSALDE
LEGSPDGYYVVVGGITPTPLGEGKSTTTVGLCQALGAFLDKKVVTCLRQPSQGPTFGIKG
GAAGGGYSQVIPMDEFNLHLTGDIHAITAANNLLAAAIDTRIFHESSQSDKALFNRLCLP
NKEGKRTFSDIMFRRLKKLGISKTKPEELTAQEIKKFARLDIDPNSITWRRVMDVNDRFL
RKITVGQGPEEKGMLRETGFDISVASEIMAVLALTTSLADMRERLGNMVVGNSKAGDPIT
ADDLGVGGALTVLMKDAINPTLMQTLEGTPVLVHAGPFANIAHGNSSIVADKIALKLVGP
GGFVVTEAGFGADIGTEKFMNIKCRYSGLMPQCAIIVATIRALKMHGGGPEVVAGRPLDH
AYTTENVPLVEAGCVNLARHISNTKSYGVNVVVAVNMFSTDTEAELSAVKNAALAAGAYD
AVVCTHHAHGGKGAVDLGIAVQKACENVTQPLKFLYPLEISIKEKIEAIARSYGAQGVEY
SEQAEKQIEMYSRQGFSGLPICMAKTQYSFSHNASEKGAPSGFVLPIRDVRASIGAGFIY
PLVGTMSTMPGLPTRPCFYDIDLDTATGKVIGLS
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgagtacatcaaggaggaagctgcaagtagtgtctcctgtaccagcagatattgacatt
gctaactcagttgagccttttcatatctctgagattgccaaggacctcaatcttagtccc
aaccattatgatctctatggaaaatacaaagccaaggtgttattgtctgctcttgatgag
cttgaaggatcaccagatgggtactatgtggttgttggagggattacgcctacaccactt
ggggaaggcaaatcaactactacggttgggctttgtcaagctttgggagcatttcttgat
aaaaaggttgtcacctgccttcgccaaccatcacaaggacctacttttggaattaaaggg
ggtgcagcaggtggtggttatagtcaggtgattccaatggacgaattcaatcttcaccta
acgggggatatccatgcaataacagctgcaaacaatctccttgcagctgctattgatact
cgaattttccatgagtcatctcaatctgataaagctcttttcaaccgattatgcctacct
aacaaagaaggaaaaagaacctttagtgatataatgtttaggcgtttgaagaagcttggt
atctccaagactaaaccagaggaactcactgcacaagaaattaagaagtttgctagactt
gatatagatccaaattcaattacatggaggagagttatggatgtcaatgaccgattcttg
aggaagattactgttggtcaaggtcctgaagaaaagggaatgctgagagaaacaggattt
gatatttctgttgctagtgagataatggcagttctggcccttactacatctcttgctgat
atgcgggaaaggcttgggaatatggttgttggaaatagcaaggctggtgaccctataaca
gctgatgatcttggtgttggaggtgctttgactgtactaatgaaagatgccatcaatcct
actctaatgcagacccttgaaggaactcctgttcttgttcatgctggtccttttgcaaac
attgctcatggaaattcttcaattgtagctgataaaattgcattgaagctggtagggcca
ggtgggtttgtggtcacagaagctggctttggtgctgatattggaactgagaagttcatg
aatattaagtgccgatatagtggtttaatgcctcagtgtgctattattgttgcaacaatc
agagccctgaagatgcatggtggtgggccagaagttgttgctggaaggcctcttgaccat
gcctacacaactgagaatgtgcctttggttgaagctggttgtgtgaatctggctaggcat
atttcaaatacaaagtcttatggggtaaatgttgttgttgctgtgaacatgttctctact
gatactgaagcagaacttagtgcagttaaaaatgcggcattggctgctggagcatatgat
gctgttgtctgtacacatcatgcccatggtgggaagggagcggtggacctaggaattgcg
gttcaaaaagcctgtgagaatgtgacacaaccactgaagtttttatatccattggaaatt
agtatcaaggagaaaatagaagctatagcaaggtcatatggtgctcaaggtgtcgagtac
tcagagcaggctgagaagcaaattgagatgtacagcagacagggattctctggtctacct
atttgcatggccaaaacccagtattcattttcccacaatgcaagtgagaagggagcaccc
agcggatttgttttaccgataagggatgtaagagcaagcattggagctggtttcatttat
cctttagttgggacaatgagtacaatgccaggacttccgacaaggccttgcttttatgac
atcgatctggacactgccacaggtaaggtaattggcctctcctga

DBGET integrated database retrieval system