KEGG   Jatropha curcas: 110010157Help
Entry
110010157         CDS       T03922                                 

Definition
(RefSeq) probable terpene synthase 3
  KO
K15803  (-)-germacrene D synthase [EC:4.2.3.75]
Organism
jcu  Jatropha curcas
Pathway
jcu00909  Sesquiterpenoid and triterpenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    110010157
Enzymes [BR:jcu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.75  (-)-germacrene D synthase
     110010157
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Terpene_synth_C ANTAR ASL_C SAM_4 ADSL_C XFP HU-CCDC81_bac_2
Motif
Other DBs
NCBI-GeneID: 110010157
NCBI-ProteinID: XP_020537387
Position
Unknown
AA seq 143 aa AA seqDB search
MLITLSFCAMGEVASKQVFDWLFTEPKLLYTASGLARLINDIMSHEFEQERGHVASAVEC
CMKQYGVSKQEAYEKLNKIVANMWKDLNEELMKEIDIPKPILMCILNIVRVMDVVYKDED
SYTHSNTSLKDILATFLVNPVAV
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgttgataaccttatcattttgtgcgatgggtgaagttgcttcaaagcaagtatttgat
tggctattcactgaacctaaacttctatatactgcatcaggtctcgcaaggctcatcaat
gacattatgtcccatgagtttgagcaagaaaggggacatgttgcttctgcagtagaatgt
tgtatgaagcaatatggtgtgtcaaagcaggaagcttacgaaaagctgaataaaatagtt
gctaatatgtggaaagatctgaacgaggagctgatgaaagaaattgatattccaaaacct
attctaatgtgcattctgaacattgtacgtgtaatggatgttgtgtacaaggatgaagat
agctatacccactccaacacttctctgaaggatattctggctacctttttagtcaatcct
gtggctgtttaa

DBGET integrated database retrieval system