KEGG   Jeotgalibaca dankookensis: BW727_100442Help
Entry
BW727_100442      CDS       T04733                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
jda  Jeotgalibaca dankookensis
Pathway
jda00471  D-Glutamine and D-glutamate metabolism
jda00550  Peptidoglycan biosynthesis
jda01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jda00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BW727_100442 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BW727_100442 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:jda01011]
    BW727_100442 (murD)
Enzymes [BR:jda01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     BW727_100442 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:jda01011]
 Precursor biosynthesis
  Amino acid ligase
   BW727_100442 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase AlaDh_PNT_C PTS_IIB Oxidored_nitro
Motif
Other DBs
NCBI-ProteinID: AQS52835
UniProt: A0A1S6IMR5
Position
447185..448567
Genome map
AA seq 460 aa AA seqDB search
MLERNRFKNKKVLVLGLAVSGFHAAKLLHELGADVTVNDAKDLSENADAQELLATGIPVV
SGYHPTDLLDDTFSFVIKNPGIPYSNEMIKQALSLGIPIFTDIELAYEIIKAPIIAITGS
NGKTTTTTMVHEILNLNRQSGIAYKAGNIGIPATTISKEALPEDDVVMELSSFQLMGIDT
FHPHIAVITNITSSHLDYHGSREAYVAAKWRITMNQTPEDYLILNWDQKELQELAQTSQA
KIIPFSRKEVLLQGAYVKEDWLYFKEEKIMPVEAIGVPGIHNIENALAALAVAKIKGASN
QSIFEALAAFGGVKHRIQFVTEIKERSFYNDSKSTNILAAQTALESFPDKPIIFLAGGLN
RGDNFDALIPYLTNVKAMIVFGQTAKKLKDIAVQAGIETIIEVEDVAAAVPKAYQISDSG
DIILLSPACASWDQYKNFEERGDVFIQAVEGLLEKEKEEA
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgttggaacgtaatcggtttaaaaataaaaaggtattggttcttggtttagctgtgagt
gggtttcatgctgcaaaattactgcatgaactaggagcagatgttaccgtcaatgacgca
aaggatttatcagaaaatgcagatgcacaagaactcctagcaactggtattcccgttgta
tctggctaccatccaactgatttattggatgacaccttctcttttgtcattaaaaatccg
ggtattccttattctaacgagatgataaagcaagctttatcattgggaattccaatcttt
acggatatagaactcgcttatgaaattatcaaagcacccataattgcgattaccggatcg
aacggaaaaacgactacaacgactatggttcatgaaatattaaacttaaatcgtcaatct
ggtattgcttataaagctggcaacattggtatcccagcaacaaccatttcaaaagaagct
ttacctgaagacgatgttgtcatggagttgtcaagttttcaactaatgggaattgatacc
tttcatccccatatcgctgtcattacgaacattacgtcttcacatttagactaccacggc
tcccgtgaggcatatgttgctgctaaatggcgtataactatgaatcaaactccagaagat
tacctcattttgaattgggaccaaaaagagctacaagaactggcgcaaactagccaagca
aaaattattcctttttctcgtaaagaagttttattgcaaggagcttatgtaaaagaagat
tggctctattttaaagaagaaaaaataatgccggtagaagccatcggtgtacccggtatt
cataacatcgaaaatgctttggctgctttagcagtagctaaaataaaaggtgctagtaac
caatcaatatttgaagctttagcggcgtttggaggcgtaaaacaccgcatccaatttgta
acagaaataaaggaacgttccttctacaatgactctaaatccacaaacattttagcagcg
caaacagctttagaaagttttcctgataaaccaattatatttctggctggcggactgaat
cgtggggataatttcgatgctttaattccatatctcacgaacgtcaaggctatgattgtt
tttggtcaaacagcaaaaaaactaaaagatattgcggtacaagcggggatcgaaacaatt
atagaagttgaagatgtcgcagcggccgttcctaaagcttatcaaataagtgattctggt
gatattattttattgtctccggcttgtgcaagctgggatcaatataaaaactttgaagag
cgtggggacgtttttatccaagctgtcgaaggtctgttagaaaaagaaaaggaggaggca
taa

DBGET integrated database retrieval system