KEGG   Jeotgalibaca dankookensis: BW727_101415Help
Entry
BW727_101415      CDS       T04733                                 

Gene name
thlA
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
jda  Jeotgalibaca dankookensis
Pathway
jda00071  Fatty acid degradation
jda00072  Synthesis and degradation of ketone bodies
jda00280  Valine, leucine and isoleucine degradation
jda00310  Lysine degradation
jda00362  Benzoate degradation
jda00380  Tryptophan metabolism
jda00620  Pyruvate metabolism
jda00630  Glyoxylate and dicarboxylate metabolism
jda00640  Propanoate metabolism
jda00650  Butanoate metabolism
jda00900  Terpenoid backbone biosynthesis
jda01100  Metabolic pathways
jda01110  Biosynthesis of secondary metabolites
jda01120  Microbial metabolism in diverse environments
jda01130  Biosynthesis of antibiotics
jda01200  Carbon metabolism
jda01212  Fatty acid metabolism
jda02020  Two-component system
Brite
KEGG Orthology (KO) [BR:jda00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BW727_101415 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    BW727_101415 (thlA)
   00640 Propanoate metabolism
    BW727_101415 (thlA)
   00650 Butanoate metabolism
    BW727_101415 (thlA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BW727_101415 (thlA)
   00072 Synthesis and degradation of ketone bodies
    BW727_101415 (thlA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BW727_101415 (thlA)
   00310 Lysine degradation
    BW727_101415 (thlA)
   00380 Tryptophan metabolism
    BW727_101415 (thlA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BW727_101415 (thlA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BW727_101415 (thlA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BW727_101415 (thlA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:jda04147]
    BW727_101415 (thlA)
Enzymes [BR:jda01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BW727_101415 (thlA)
Exosome [BR:jda04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BW727_101415 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AQS53782
UniProt: A0A1S6IQF6
Position
complement(1439903..1441087)
Genome map
AA seq 394 aa AA seqDB search
MMREVVIVQALRTPMGAFGGALKNVSAVDLGAHAVKEAMASINLDPSLVDELIFGNVLSA
GLGQNVARQVAVNSGIPKHVPSFTINKVCGSGLKTVALAAQSIIAGDNEIVIAGGTEVMS
QAPYVVNDARWGARMGDTKMVDTMLKDGLMDAFNDIHMGMTAENIVEKYGFTRQQQDELA
VLSQNNAEKAIKSGRFKDEIIPFPVPQRRGEPVVFDTDEYPRFGTTMESMSKLKPAFKRD
GGTVTAGNSSGLNDGAAVVIVMSKEKAEELGFEPMATIKSYASAGVEPKIMGCGPIPATK
KALKKANLEVSDLELIEANEAFAAQALSVITDLGLDTSITNVNGGAIALGHPIGASGARI
LVTLLHEMKKRDSKRGLATLCIGGGQGIALVVER
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgtgaagtagttattgtacaagcactaagaacaccaatgggagcttttggagga
gcattgaaaaatgtttcagctgttgatttaggagcgcatgctgttaaagaagcaatggca
agtattaatctagatcctagcctagtcgatgaattaatttttggtaatgtattgagcgca
gggctcggacaaaacgtagcacgtcaagtagctgttaactcagggattccaaaacacgtt
ccatcatttacaattaataaagtgtgtggttcagggttaaaaacagtggcattagcagca
caatctattattgcaggggacaacgaaattgtgatcgccggtggaaccgaagtgatgagt
caagcgccttacgttgtgaacgatgcgcgttggggtgcacgtatgggtgatacaaaaatg
gttgataccatgcttaaagatgggttgatggatgcttttaatgacattcatatgggtatg
acagcagaaaacatcgttgaaaaatacggttttaccagacaacaacaagatgaattagct
gtattgagtcaaaataatgctgaaaaagcaattaaatcaggccgttttaaagatgaaatt
attccgttcccagtcccacaaagaagaggcgaacctgttgtttttgatacagacgaatat
cctcgctttggaacaactatggaatctatgagtaaacttaaacctgctttcaaacgtgat
ggcggaaccgttacagctggaaattcatccggattaaatgatggcgcagcagtagtcatt
gttatgtcaaaagaaaaagctgaagagctaggatttgaaccgatggcaacaatcaagtct
tatgcaagtgcgggagtagaaccgaaaattatgggttgtggaccaattccagcaaccaaa
aaagcattgaaaaaagcaaatctagaagtatctgatttagaattaattgaagcaaacgaa
gcatttgcggcgcaagcgttaagtgttattacagaccttggcttagacacaagtattact
aacgttaatggtggtgcgatagccctcggacacccaattggtgcaagtggcgctcgtatc
cttgtaacactcttacatgaaatgaaaaaacgtgattcgaaacgcggtttagctacccta
tgtattggtggcggacaaggaattgctttagttgtagaaagataa

DBGET integrated database retrieval system