KEGG   Jeotgalibaca dankookensis: BW727_101600Help
Entry
BW727_101600      CDS       T04733                                 

Gene name
mdlD
Definition
(GenBank) NAD(P)-dependent benzaldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
jda  Jeotgalibaca dankookensis
Pathway
jda00010  Glycolysis / Gluconeogenesis
jda00053  Ascorbate and aldarate metabolism
jda00071  Fatty acid degradation
jda00280  Valine, leucine and isoleucine degradation
jda00310  Lysine degradation
jda00330  Arginine and proline metabolism
jda00380  Tryptophan metabolism
jda00561  Glycerolipid metabolism
jda00620  Pyruvate metabolism
jda00625  Chloroalkane and chloroalkene degradation
jda01100  Metabolic pathways
jda01110  Biosynthesis of secondary metabolites
jda01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:jda00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BW727_101600 (mdlD)
   00053 Ascorbate and aldarate metabolism
    BW727_101600 (mdlD)
   00620 Pyruvate metabolism
    BW727_101600 (mdlD)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BW727_101600 (mdlD)
   00561 Glycerolipid metabolism
    BW727_101600 (mdlD)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BW727_101600 (mdlD)
   00310 Lysine degradation
    BW727_101600 (mdlD)
   00330 Arginine and proline metabolism
    BW727_101600 (mdlD)
   00340 Histidine metabolism
    BW727_101600 (mdlD)
   00380 Tryptophan metabolism
    BW727_101600 (mdlD)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BW727_101600 (mdlD)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BW727_101600 (mdlD)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BW727_101600 (mdlD)
Enzymes [BR:jda01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BW727_101600 (mdlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DRTGG
Motif
Other DBs
NCBI-ProteinID: AQS53966
UniProt: A0A1S6IQZ3
Position
complement(1618986..1620356)
Genome map
AA seq 456 aa AA seqDB search
MFNIKEIINNQNNYFEKGQTKDLTFRLNKLTVLKKMIAENDEAIMAALKKDLNKAPFESY
ETEIGILLEEINYVIKNLPRWDKRKKVCTPLINFLSSSHVYSEPYGVALVISPWNYPFQL
TISPLIGSIAAGNCTLIKPSEYSVYTSELLEDLIARYFEPGFISVVKGDKDVSQQLLEEK
FDYIFFTGSVEVGKIIMKAASKHLTPVTLELGGKSPCIIDETADLDLAAKRIVWGKFLNA
GQTCIAPDYLLVQSTIEKALVSKIETYIEQFYGKEPHRNDDYPKIISMNHFQRLLNLLKD
QKIIAGGNYDLNSQQIEPTLLGAVSWDSPVMQEEIFGPILPIITFDTIDEVIRSVNNRPK
PLALYYFSTNKKRQNKIIEEISFGGGCVNDTIMQVGSSYMPFGGVGESGMGSYHGKASFD
TFSHKKSVVHKSNLVDINLRYPPFKNKLKWIKKVMR
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
ttgtttaatattaaagaaataataaataaccaaaataattattttgaaaaagggcaaacc
aaagacttaacgtttcgtttaaataaattaacggtacttaagaagatgattgccgaaaat
gatgaagctatcatggcagctctaaaaaaagatttaaataaagctccttttgaatcctat
gaaacagaaatcggtattttactcgaggaaattaactacgtcataaaaaaccttccaaga
tgggataaaagaaaaaaagtttgcacacctttgataaattttttgtcaagtagtcatgtc
tattcagaaccctatggtgttgcccttgttatatcgccttggaattatccttttcaatta
acaatctcacctttaattggttctatagccgcaggtaactgtacgcttattaagccctct
gagtattccgtatatacgagtgagcttttagaagatttaatagcacgctattttgaacct
ggctttatttcagtggtaaaaggtgataaggatgtgagccagcaactcttagaagaaaaa
tttgattacatcttttttactggtagcgtagaggttggaaagataatcatgaaagctgct
tctaagcacttgacacccgtaacgttggaactaggtggtaaaagcccttgtattatagat
gaaacggcagatttggatttagcggccaagaggattgtttgggggaaatttttaaatgct
gggcaaacctgcattgcccctgactacttgttagtacagtcgactatagaaaaagcgctt
gttagtaaaattgaaacctacattgaacagttttacggcaaagaaccacatcgaaatgac
gattaccctaaaattataagcatgaatcattttcagaggttgttaaatttgctaaaggat
caaaaaattatagctggtggaaattatgacctaaattcccagcaaatagagccaactcta
ttgggagctgtcagttgggatagtcccgttatgcaagaagagatatttggacccatttta
ccaattataacgtttgatacaatcgatgaggttatcaggagcgtcaataatcgcccaaaa
cccttagcactgtattatttttcaaccaataaaaaacgccaaaataaaattattgaagaa
atttctttcgggggtggttgtgtcaacgataccattatgcaagttggaagctcctacatg
ccttttggtggggtcggtgaaagtggtatgggaagttaccatgggaaagcaagctttgat
actttttcacataaaaaaagtgttgttcacaaatcaaatctagtggatattaatttaagg
tacccaccattcaaaaataagcttaaatggataaaaaaagtaatgcgataa

DBGET integrated database retrieval system