KEGG   Jonesia denitrificans: Jden_0784Help
Entry
Jden_0784         CDS       T00972                                 

Definition
(GenBank) Alcohol dehydrogenase zinc-binding domain protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
jde  Jonesia denitrificans
Pathway
jde00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:jde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Jden_0784
Enzymes [BR:jde01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Jden_0784
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Jden_0784
    1.1.1.-  
     Jden_0784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C FAD_binding_3 ADH_zinc_N_2 AdoHcyase_NAD HI0933_like adh_short
Motif
Other DBs
NCBI-ProteinID: ACV08446
UniProt: C7R1X8
Position
839530..840591
Genome map
AA seq 353 aa AA seqDB search
MKAARYYDRKDIRIEDIDEPQLQPGTVAIDVAWCGICGTDLHEYLEGPIFIPPKGSPHPI
SGEEAPITMGHEFSGVVTALGEGVTDVAVGESVVVEPYIIRSDVDTTPGQSYQLSPDMNF
IGLGGRGGGLSEKIVVERRWVHPVGDIPLDQAALIEPLAVGHHAFVRSAAQAGDVAIVGG
AGPIGLLTAAVLKAKGLTVYVSEVSTARKDKARSTGVADAVFDPREVDVAAEVRELTGGH
GADVGFECSSVPVVLDMLMDAVRPGGVIVNVSIWGHKPEVDLPALVLKEIDLRGTIGYAG
DHPATIQLVQEGKVDLAPFITARIGLDDLVAQGFTQLIENNEHHVKIIVNPRG
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagcacggtattacgaccgcaaagatatccggattgaagacatcgatgagccg
caactgcaaccaggtacggttgccattgatgtggcctggtgcgggatttgtggaacagac
cttcatgagtatcttgaaggtcccattttcatcccgccgaaaggtagcccacacccgatc
tctggggaagaagcccctatcacgatggggcacgaattctcaggggttgtgaccgcgctg
ggggagggggtcacagatgtggcagtgggtgagtctgttgtcgtggagccgtacattatc
cggtccgatgtggacacaacaccggggcagtcctatcaactgtcgcctgacatgaacttc
attgggcttgggggccgcggcggtgggctctctgagaaaatcgttgtggaacgccgctgg
gttcatcctgttggtgacattccccttgatcaggcggcactcattgaaccattggcagtt
gggcatcatgcgtttgtgcggtcagcagcacaagcgggggacgtcgcgatcgtgggcggg
gctggtcccattgggctactcacggctgcggtgttgaaggctaaaggactgactgtttac
gtctctgaagtgtccacggcccgcaaggacaaggcacggtcaacgggggtggcagatgcg
gtgtttgaccctcgtgaggtggatgtcgccgctgaggtgcgtgaattgaccggtggccat
ggcgccgatgtggggtttgaatgttcttcggtcccggttgttcttgacatgctcatggat
gcggtgcgcccgggcggcgtcatcgtgaacgtgtctatttggggtcacaagcctgaggtg
gacctccccgcgttggtgctgaaggaaatcgatctgcgcggaacgatcggttatgcggga
gatcacccggccaccatccaactcgtgcaagagggcaaagtggacctcgctccctttatt
actgcacggattgggttagacgacttggtggcgcaaggtttcacgcaacttattgagaac
aatgagcaccacgtcaaaatcattgtcaatccacgtgggtag

DBGET integrated database retrieval system