KEGG   Jonesia denitrificans: Jden_0829Help
Entry
Jden_0829         CDS       T00972                                 

Definition
(GenBank) pyrimidine-nucleoside phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
jde  Jonesia denitrificans
Pathway
jde00240  Pyrimidine metabolism
jde01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jde00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Jden_0829
Enzymes [BR:jde01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Jden_0829
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N DUF2254 TMP_2 Biotin_lipoyl
Motif
Other DBs
NCBI-ProteinID: ACV08491
UniProt: C7R2C0
Position
891294..892589
Genome map
AA seq 431 aa AA seqDB search
MTTHLFDTVDVIRAKRDGRELTSEEIAWVIDAYTHDHVADYQMAALNMAILLNGMTRREI
ADWTRAMIESGERMNFDQLSRPTADKHSTGGVGDKITLPLAPLVAVFDVAVPQLSGRGLG
HTGGTLDKLEAIAGWRAALTNDEMMHQLDTVGAVICQAGSGLAPADRKLYALRDVTGTVE
AIPLIASSIMSKKIAEGTSALVLDVKVGSGAFMKNVDQARELARTMVDLGTDAGVTTTAL
LTDMSTPLGLTVGNALEVRESIEVLAGGGPADVVDLTVALAAEMLAGAGKTTAEDDIRAA
LNDGRAMDAWRAMIAAQDGDNDAALPVAAEQHVITAPRSGYLTTLDAYAVGVASWRLGAG
RARKDDQVQAGAGIELHAKPGDKVTAGAPLMTLHTDTPERFDRAIEIAEEGVVISDDAPT
NSPSLIIDRLA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaccacccacctcttcgacactgttgatgtcatccgggccaagcgtgatggacgtgaa
ctgaccagcgaagaaatcgcctgggtcatcgatgcctacacccacgaccacgtggccgat
taccaaatggctgccctgaacatggccatcttgctcaacggcatgacccgccgggaaatc
gctgactggacccgggcgatgatcgaatcaggcgaacgcatgaactttgatcagttgtcc
cgccccaccgcggacaaacactccaccggcggagtgggagacaaaattactctcccattg
gcacccctcgttgccgtgtttgacgtggccgtcccccaactgtctgggcgtggactgggg
cacactggtggcacgctcgacaaactcgaagcgatcgccgggtggcgcgctgcactcacc
aacgacgaaatgatgcaccaactggacacggtgggggcggtgatctgccaagcgggttca
ggtcttgcaccagcggaccggaagctgtacgcactgcgcgatgtcacgggaaccgttgaa
gcgatcccactgattgcatcgtcaatcatgagcaaaaaaatcgcagaaggaacgtctgcg
ctggttcttgacgtcaaagtcggctccggggcatttatgaaaaatgtggaccaagcacgg
gaactcgcccggacaatggtggatctggggaccgacgctggtgtaacaacaactgcgcta
ctcaccgacatgtccacgccgctcggactcaccgttggaaatgcccttgaggtgcgtgaa
tccattgaggtgttggccggaggcggccctgcagatgttgttgatctgacagttgccctc
gcagcagaaatgctcgctggagctgggaagacaaccgcagaagacgacatccgcgcagca
ctgaacgatggtcgtgcgatggatgcgtggcgtgccatgatcgcagcgcaagatggtgac
aatgatgcagcattgcccgtggcagcagagcagcatgtcatcaccgctccgcgcagtggg
tacctcaccacccttgacgcatacgcggtcggtgtcgcctcgtggcggctcggtgcaggc
cgcgcccgaaaagacgatcaggttcaagccggtgccggaattgaactgcatgcaaagcca
ggggacaaggtaacggcaggagccccactgatgactctgcacaccgacaccccagaacgg
ttcgaccgtgcgatcgagatcgctgaggaaggtgttgtgatcagtgatgacgcaccaacc
aactcgccatcgctcattatcgaccggctcgcatga

DBGET integrated database retrieval system