KEGG   Jonesia denitrificans: Jden_1441Help
Entry
Jden_1441         CDS       T00972                                 

Definition
(GenBank) glucokinase, ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
jde  Jonesia denitrificans
Pathway
jde00010  Glycolysis / Gluconeogenesis
jde00052  Galactose metabolism
jde00500  Starch and sucrose metabolism
jde00520  Amino sugar and nucleotide sugar metabolism
jde00521  Streptomycin biosynthesis
jde01100  Metabolic pathways
jde01110  Biosynthesis of secondary metabolites
jde01120  Microbial metabolism in diverse environments
jde01130  Biosynthesis of antibiotics
jde01200  Carbon metabolism
Module
jde_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:jde00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Jden_1441
   00052 Galactose metabolism
    Jden_1441
   00500 Starch and sucrose metabolism
    Jden_1441
   00520 Amino sugar and nucleotide sugar metabolism
    Jden_1441
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Jden_1441
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Jden_1441
Enzymes [BR:jde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Jden_1441
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Glucokinase FGGY_N
Motif
Other DBs
NCBI-ProteinID: ACV09091
UniProt: C7R4N4
Position
complement(1550650..1551594)
Genome map
AA seq 314 aa AA seqDB search
MHAIGVDIGGTKIAAGVVDEFGNILAQTRVATAAGDPASIDASIAQVCEILAAEHTVGAI
GLAAAGFCSPDRTSVQFAPNIMWRDYPIADKVRALLGTEIPIVVENDANAAGWAEYRFGA
AREATDMLMLTIGTGLGGALVVNDQLVRGRYGVGGEVGHMRVVPNGHTCGCGHDGCWEQY
ASGSALVREARAMAIKSPQRAQLLIDLAGGDVELITGPLVTTAAQQGDEFSQSLLAELGR
WIGEGAASVAALLDPEVVVIGGGVAAAGNLLLQPSIDAFVTSLPARGHRVEARFALAKMG
NEAGIVGAADLARQ
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgcacgccattggcgttgatatcggcggaacaaaaatcgccgcaggtgtggttgacgaa
ttcggcaacattttggctcagactcgtgtggcgacagctgcgggtgatccggcaagtatt
gacgcttcgattgcgcaagtgtgcgagattctagcggctgagcacacggttggtgccatc
ggattggctgcggcagggttttgttcacctgaccgaacgtcagttcaatttgcccccaac
atcatgtggcgtgactaccctattgcggacaaagtccgtgcactgttgggaacagagatc
cctattgtggtggaaaacgatgccaatgctgccgggtgggctgagtaccgttttggggcc
gctcgtgaagctacagacatgttgatgctgactatcgggacgggccttggtggcgccttg
gtggttaatgatcaattggttcgcggccggtatggggttggtggcgaggtcggtcacatg
cgtgtcgtccctaatgggcacacatgcgggtgtggccatgatggctgctgggagcagtat
gcgtcgggatcagctctcgtgcgcgaggcgcgagcgatggccattaagtcgccgcagcga
gcgcaacttctcattgatcttgctggtggagatgttgagttgattacgggtcctttggtg
acgaccgccgcacagcagggcgatgagttctcccagtctcttcttgccgagttgggtcgc
tggatcggtgaaggagcagcatctgttgctgctttgttagaccctgaggtggttgttatt
gggggtggggttgcggctgcggggaatctcctcctccaaccgtctatcgatgcgtttgtg
acgtcgctgcctgcccgtgggcaccgggtggaggctcgatttgcgttggcgaagatgggg
aacgaggcaggcattgtgggcgccgccgatcttgctcgacagtag

DBGET integrated database retrieval system