KEGG   Jonesia denitrificans: Jden_1475Help
Entry
Jden_1475         CDS       T00972                                 

Definition
(GenBank) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
jde  Jonesia denitrificans
Pathway
jde00010  Glycolysis / Gluconeogenesis
jde00020  Citrate cycle (TCA cycle)
jde00260  Glycine, serine and threonine metabolism
jde00280  Valine, leucine and isoleucine degradation
jde00620  Pyruvate metabolism
jde00630  Glyoxylate and dicarboxylate metabolism
jde00640  Propanoate metabolism
jde01100  Metabolic pathways
jde01110  Biosynthesis of secondary metabolites
jde01120  Microbial metabolism in diverse environments
jde01130  Biosynthesis of antibiotics
jde01200  Carbon metabolism
Module
jde_M00009  Citrate cycle (TCA cycle, Krebs cycle)
jde_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
jde_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:jde00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Jden_1475
   00020 Citrate cycle (TCA cycle)
    Jden_1475
   00620 Pyruvate metabolism
    Jden_1475
   00630 Glyoxylate and dicarboxylate metabolism
    Jden_1475
   00640 Propanoate metabolism
    Jden_1475
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Jden_1475
   00280 Valine, leucine and isoleucine degradation
    Jden_1475
Enzymes [BR:jde01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     Jden_1475
Exosome [BR:jde04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Jden_1475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox GIDA Pyr_redox_3 FAD_oxidored HI0933_like AlaDh_PNT_C FAD_binding_2 NAD_binding_8 3HCDH_N DAO Trp_halogenase Thi4
Motif
Other DBs
NCBI-ProteinID: ACV09124
UniProt: C7R4V4
Position
1581037..1582422
Genome map
AA seq 461 aa AA seqDB search
MAETAGTDFDIVVLGGGSGGYAAALRAAQLGQNVALIEADKLGGTCLHYGCVPTKALLHA
AEVAESVREGHQFGVNATFNSIDMDGVNSYKANVINGLYKGLQGLIKSRKITVVEGYGKL
VGPNSVEVNGQRYNGKHVILATGSYSRTLPGLAIEGRVMTSDQALTLDYVPKSAIILGGG
VIGCEFASVWRSFGADVTIIEGLPHLVPNEDESISKALERAFRKRKINFNLGDLFSSVTQ
DDNGVHVTLQSGKTFDAEIMLVAIGRGPRTADLGYEEQGIRMDRGFVLTDDRLHTGVANI
WAVGDIVPGLQLAHRGFAQGIYVAEQILGLNPAPIVESGIPRVTYSEPEIASVGLTEKKA
QEEFGADNVETLDYNLAGNGKSKILATQGFIKLVRQKDGPVVGVHMIGSRVGELVGEGQL
IVNWEAYPEDVASLIHAHPTQNEALGEAFLALAGKPLHAHN
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
gtggccgaaaccgccggcaccgactttgacatcgtcgtcctgggtggagggagcggtggt
tacgccgccgcgctccgcgccgcacaactcggacagaacgtcgcactcatcgaagcagac
aaactcgggggcacttgccttcactatggttgtgtccccaccaaagcactcctccacgca
gctgaggtcgctgaatcagttcgtgagggtcaccaatttggggtcaacgctacgttcaac
tccatcgacatggacggcgtcaactcctacaaagccaacgtcattaacggcttgtacaaa
ggccttcaaggtctcattaagtcacgcaagatcaccgtagtcgaaggctacggaaaactg
gtaggccctaacagcgtggaggtcaacggccaacgctacaacgggaagcacgtcattttg
gccaccgggtcatactctcgtaccctgccaggacttgccatcgaaggtcgggtcatgacc
tccgaccaagccctcacgcttgactatgttcccaagtcagcaattatcttgggtggtggc
gtcatcgggtgtgagttcgcatctgtgtggcgttcctttggcgcggacgtcaccatcatt
gaaggactaccgcacctggtgcccaacgaagacgaatcgatctccaaggcgttggaacgt
gcgttccgcaaacggaaaattaacttcaaccttggcgacctgttctcctcagtcacccag
gacgacaacggtgttcacgtcaccctccaatcaggcaaaaccttcgatgcggagatcatg
ctcgttgcgatcggtcgtggaccacgcaccgctgaccttgggtacgaagaacaaggcatc
cgcatggaccgcggttttgtcctcacagatgacaggctccacacgggtgttgcaaacatt
tgggcagttggcgacatcgtgcccgggcttcaactagcgcaccgtggttttgcacaaggc
atctacgtggcggagcagattttgggtctcaaccctgcacccatcgtggaatccggtatc
ccacgtgtcacctattctgaacccgaaatcgcgtctgttgggttgaccgaaaagaaagct
caagaagagttcggcgccgacaacgtggaaacccttgactacaacctcgctggaaacgga
aagtcaaaaatccttgctacccaagggttcattaaactagtccgccaaaaagatgggcct
gtggtgggtgtccacatgattgggtcccgtgtcggagaactcgttggagaaggccaactc
attgtcaactgggaagcatacccagaggacgtggcttccctcattcacgcacaccccact
caaaacgaagccctcggcgaagcattcctcgctcttgccggcaagcccctgcacgcccac
aactga

DBGET integrated database retrieval system