KEGG   Jonesia denitrificans: Jden_1476Help
Entry
Jden_1476         CDS       T00972                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
jde  Jonesia denitrificans
Pathway
jde00020  Citrate cycle (TCA cycle)
jde00310  Lysine degradation
jde01100  Metabolic pathways
jde01110  Biosynthesis of secondary metabolites
jde01120  Microbial metabolism in diverse environments
jde01130  Biosynthesis of antibiotics
jde01200  Carbon metabolism
Module
jde_M00009  Citrate cycle (TCA cycle, Krebs cycle)
jde_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:jde00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Jden_1476
  Amino acid metabolism
   00310 Lysine degradation
    Jden_1476
Enzymes [BR:jde01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Jden_1476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biotin_lipoyl 2-oxoacid_dh E3_binding Biotin_lipoyl_2 HlyD_3 GCV_H
Motif
Other DBs
NCBI-ProteinID: ACV09125
UniProt: C7R4V5
Position
1582447..1584546
Genome map
AA seq 699 aa AA seqDB search
MSNTVKMPALGESVTEGTVTRWLKNVGDTIEVDEPLLEVSTDKVDTEIPSPFSGVLEAIL
VEEDDTVEVGADLATIGDGSGASSAQPATSEQPASPQEAAPAQQQAPAEQPAQPSAATPA
SGDGEKVTLPALGESVTEGTVTRWLKNVGDTIEVDEPLLEVSTDKVDTEVPSPVAGVVTQ
ILVEEDETVEVGAVLAIIGDGSTPAPQQQPAQQPASPQEAAPAQQQAPAEQPAQPSAATP
ASGDGEKVTLPALGESVTEGTVTRWLKNVGDTIEVDEPLLEVSTDKVDTEVPSPVAGVVT
QILVEEDETVEVGAVLAIIGDGSTPAPQQQPAEEPAPVAPQPAVPSEAAQQAAPPAQSSP
TPAQESAATPARAPQSTPAAAPAARGGYVTPLVRKLASEKGVDLSTVTGTGIGGRIRKED
VLEAAQKAAQPAAAPQRAEQPAPSTSTDGSTAPTTILPVSELRGTTEKASRLRQIIAERM
VEALQTQAQLTTVMEVDVTAVVRLRSKVKEAFKAKHGANLTFLSFYALAAAEALKAYPKI
NGVLEDKTITYPDAEHIGIAVDTPRGLLVPVIKNAGDLDLAGFATSITDLGSRTRDNKVK
PDELSGATFTITNTGSGGALFDTPIVPVGTSAILGTGTMVKRPAVVAGPDGEDVIAIRTF
TYLSISYDHRLVDGADASRFLSAVKARIEEGKFEDFLGL
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgtctaacactgtgaaaatgcccgcgctgggcgaatccgtcaccgaaggaaccgttacc
cgctggctgaagaacgtgggcgacaccatcgaggtcgacgaaccactccttgaggtgtcc
accgacaaagtcgacaccgaaattccctctccattttctggagtactcgaagctatcctc
gtcgaagaagatgacactgtggaggtcggggccgatctcgcaacaattggtgacggctca
ggcgcgtcatcagctcagcctgcaacctccgaacagcctgcttcgccacaagaggctgct
cctgctcaacagcaggcacctgccgagcagccagctcagccctcagctgcaacaccggct
tcaggcgatggcgaaaaggtcactcttcccgcactcggcgaatccgtcaccgaaggaacc
gtgacccgctggctgaagaacgtgggcgacaccatcgaggtcgacgaaccactccttgag
gtatccaccgacaaagtcgacaccgaggtgccctcaccggtcgctggtgtggtcacacaa
atccttgtcgaggaagacgaaacagttgaggtcggcgcagtcctcgccatcatcggcgac
ggctccacacccgcaccacaacaacaaccagcacaacagcctgcttcgccacaagaggct
gctcctgctcaacagcaggcacctgccgagcagccagctcagccctcagctgcaacaccg
gcttcaggcgatggcgaaaaggtcactcttcccgcactcggcgaatccgtcaccgaagga
accgttacccgctggctgaagaacgtgggcgacaccatcgaggtcgacgaaccactcctt
gaggtgtccaccgacaaagtcgacaccgaggtgccctcaccggtcgctggtgtggtcaca
caaatccttgtcgaggaagacgaaacagttgaggtcggcgcagtcctcgccatcatcggc
gacggctccacacccgcaccacaacaacaaccagcagaagaacccgccccggtggcacca
cagcctgcggtgccttcggaagcagcacaacaagcggccccacctgcgcagtcctccccc
actccggctcaggaatctgctgcgacaccagctcgtgcaccgcagtcaactcccgcagca
gcacctgctgcacgaggtggatacgtgacaccactggtccgcaagctcgcctccgagaag
ggagtggacctgtccacggtgacaggcaccggcattggcggacgcatccgcaaggaagat
gtgctcgaggctgcacagaaagctgcgcaacccgctgccgcaccgcaacgagctgaacag
ccagcaccaagcacatcgacagatggctcaacagcacccacgacaatcctcccggtctcg
gaactgcgcggaacaacagagaaagcgtcacgcctgcgccagatcattgctgagcgcatg
gtcgaagcactccagacgcaagctcaactcaccaccgtcatggaagtcgacgtcaccgca
gttgtgcggctacggtccaaggtcaaggaagcgttcaaagcaaagcacggtgcgaacctc
acgttcctgtcgttctatgcgttagccgcagccgaagcgttgaaggcttacccgaagatc
aacggtgtcctggaagacaaaaccatcacctacccagacgccgaacacatcggtatcgcc
gtggacacaccacgtgggttgttggttcccgtcatcaagaacgcaggcgacctcgacctc
gccggattcgccacctcgatcaccgaccttggttcacggacccgcgataacaaggtcaaa
cccgatgagttgtcaggcgctaccttcaccatcaccaacacagggtctggtggcgccctg
ttcgacacacccattgtcccggtaggaacctccgcgatcctgggaacaggcaccatggtg
aaacgaccagcagtggttgctggccctgacggtgaggatgtcatcgccatccgcaccttc
acctacctgtccatttcctacgaccaccggctggttgacggagctgacgcgtcacgcttc
ttgtccgcggtcaaggctcggatcgaagagggtaagttcgaggacttcctcggcctgtag

DBGET integrated database retrieval system