KEGG   Jonesia denitrificans: Jden_2217Help
Entry
Jden_2217         CDS       T00972                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
jde  Jonesia denitrificans
Brite
KEGG Orthology (KO) [BR:jde00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Jden_2217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ACV09854
UniProt: C7R1L9
Position
complement(2401803..2403086)
Genome map
AA seq 427 aa AA seqDB search
MTLLVLVVATALAFDFTNGFHDTGNAMATSIATRALRPKIAVALSAVLNFVGAFLSLAVA
ATIAKGIVDANVITLEVVLAGLVGGIVWNLITWLYGIPSSSSHALVGGMVGAVLAAAGTS
GVLWEGVIAKVLLPALIAPVLAIFVAAVGTWTVARVTASVPKETQDKTFRWGQIGSASLV
SLAHGTNDAQKSMGIILLALIAAGAVPADSSVPLWVIIACASFMALGTYTGGWRVIRTLG
KGLVEIDSRQGMAAETSSAAVILMSSHFGYSLSTTHVATGSVMGSGVGMPGAKVRWGVAK
RMFLAWMITLPAAGLVGGLCFGLQHLIGGAAGSITVFALLIAVSTWLFLESRRKPVNPDN
VNEEWDDNNEPIDIRSRRTADAVASDVDAQAVTTSQDPAEAEVLVAVGTAGDFASGDDES
STVKDGQ
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgacactcctcgtccttgtcgtagcaacagcgctcgccttcgatttcacgaacggcttc
cacgacacgggcaacgccatggccacatccattgccacccgggccttgcgccccaaaatt
gcggtcgcactgtctgcagtgttgaacttcgtgggagcgttcctctccctcgcagtggct
gcaacgatcgcgaagggaattgttgacgccaacgtcattaccctcgaagttgttcttgcc
gggcttgtcggcgggatcgtgtggaacctcattacctggctgtacggcatcccgtcgtcg
tcctcccatgcgcttgttggaggaatggtgggggctgttcttgcggcagcaggcacctct
ggcgtgttgtgggaaggggtgatcgccaaggttctcttgcctgcgttgatcgctccggtc
ctcgccatctttgttgcagcagtaggaacctggaccgttgctcgcgtgaccgcgagtgtc
ccgaaagaaacccaagataaaacgttccgttggggccaaattgggtccgcatcgcttgtt
tctttggcgcatggaacaaacgatgcgcaaaagagtatgggtatcatcttgctcgccctg
atcgcagcgggggctgtgcctgcagattcctctgtcccgctgtgggtcatcattgcgtgt
gcctcgttcatggcgcttggcacctacaccggtggatggcgggtcattcgcactttgggt
aagggcttggtggagattgactcccgtcagggaatggctgcggagacctcgtctgcggcg
gtcattctcatgtcttcccactttgggtattcactgtccacgacgcacgtggccactggt
tccgtcatggggtcgggtgtgggtatgcctggggcgaaggtgcgctggggtgttgccaag
cgcatgttcctggcgtggatgatcacgctgcctgcggcaggtcttgtgggtgggctgtgc
tttggcctgcagcacctgattggcggagctgctggttcgatcactgtttttgctctcctc
attgcagtgtcaacgtggctgttccttgagtcgcgccgcaaaccagtgaacccggacaat
gtgaacgaggaatgggacgacaacaacgagccgatcgacatccggtcacgtcgtaccgct
gacgctgtggcgtcggatgttgatgcgcaagcggtgacgacctctcaggatccggctgag
gccgaggttcttgtggcggttggtactgctggtgatttcgcgtcaggtgatgacgagagt
tcgactgttaaggacggtcagtga

DBGET integrated database retrieval system