KEGG   Jonesia denitrificans: Jden_2486Help
Entry
Jden_2486         CDS       T00972                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
jde  Jonesia denitrificans
Pathway
jde00860  Porphyrin and chlorophyll metabolism
jde01100  Metabolic pathways
jde01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:jde00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Jden_2486
Enzymes [BR:jde01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Jden_2486
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Jden_2486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_binding_2 Pyr_redox_2 HI0933_like FAD_oxidored Pyr_redox FAD_binding_3 GIDA Thi4 Pyr_redox_3 AlaDh_PNT_C NAD_binding_9 Lycopene_cycl UDPG_MGDP_dh_N ApbA 3HCDH_N MCRA Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: ACV10118
UniProt: C7R370
Position
2669914..2671302
Genome map
AA seq 462 aa AA seqDB search
MTSVTIIGAGIAGLTAAHHLAVRGNKVTLVDASSQVGGFLAPLQMSGPHGDLLLDAGAES
FATRAPAVSALVTSLGLQVTSPEDRAGWCVPDRSSAFPLPSAGVLGIPVDPFAADARAAL
GWVGSVRAWVDRILPPRVGDTSNLDAFVRSRMGNKVADRLVSAIVGGVHSTSPTLLDVSA
IHPKFREYFADEGTLTGVVKRIRAAAPAGRAVSGIVGGLHTLPSTLYQSISAAGGTVLLD
EAVTALTQRDGRWVVQGTSGQDVSVSDHIIIALPARPALALLADTGIYDAGDQLNQVARG
TDIALATVVVHSKQLGSYPRGTGVLVSPDAGFQAKASTHANAKWGWVDEAVISAFGPDHH
VIRLSFGRHGDHLPTDDAAIVAHAATEVPALYGVSDCAVAASAVVRWPDALAPVTPTMRA
VASAAVAATTDSGLHIAGSWVAGTGLAATIPHAQGVAERIVN
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
gtgacctccgtaacgatcattggcgctggaattgctggtctcaccgctgcacatcacctt
gcggttcgcggcaacaaggtcacacttgtcgatgcgtcatcccaggtgggtggatttctt
gcgccgttgcagatgagcggacctcatggtgaccttcttctcgatgcgggggctgaatct
tttgctacccgagctcctgcggtctctgctctggtgacgtctctcggtttgcaggtgaca
agccctgaggatcgggctgggtggtgtgttccggatcgttcgtcagcgtttccgctgccc
tcagctggggtgttgggtatccccgtcgacccgtttgccgccgatgcccgcgcggccctg
gggtgggttggatcggttcgcgcctgggtggaccggatccttccgccgcgggtgggtgac
acctcgaacctggatgcttttgttcgttctcggatgggcaacaaggttgctgaccggctt
gtgtctgcaattgtgggaggtgtgcattccacgtcaccgaccctgttggatgtctccgcg
attcacccaaaatttcgggagtactttgccgatgagggcaccctgactggggtggtgaaa
cgcattcgtgcggcggctcctgctgggcgcgctgtcagtgggatcgtcggtgggttgcac
actctgccctccactctttatcagagtatttctgctgctggtggaactgttctcctcgat
gaagcggtgaccgcgttgacacagcgcgatgggcgctgggtggtgcaggggacgtcaggc
caggacgtgagcgtcagcgaccacatcatcattgcgttgcctgctcgaccggcactggcg
ttgctcgctgacacgggaatctatgacgctggtgatcagctaaaccaggtggcccgtggc
accgacattgcgctggccactgtggttgtgcactccaagcagctgggttcctaccctcgt
ggaactggtgtgcttgtgtcaccggacgctgggttccaagcgaaagcttccacgcatgct
aatgcaaagtgggggtgggttgatgaggctgtcatcagcgcttttggtcccgatcatcat
gtcattcggttgagttttgggcggcatggcgatcacctacccaccgatgacgccgccatt
gtggcacacgctgccactgaagttcctgcactgtatggggtcagtgactgcgccgttgcg
gccagcgccgtggtgcggtggccggacgccttggccccggtgactcccacgatgcgtgcg
gtggcctccgctgcggtggcagcaaccacagattcgggtcttcacattgccggctcgtgg
gtggctggcactgggctagcagcgacgattcctcatgcccagggggttgctgagcgtatt
gtgaactga

DBGET integrated database retrieval system