KEGG   Jeotgalibaca sp. H21T32: EJN90_10330Help
Entry
EJN90_10330       CDS       T05782                                 

Definition
(GenBank) methyltransferase domain-containing protein
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
jeh  Jeotgalibaca sp. H21T32
Brite
KEGG Orthology (KO) [BR:jeh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:jeh03009]
    EJN90_10330
Enzymes [BR:jeh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     EJN90_10330
Ribosome biogenesis [BR:jeh03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    EJN90_10330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_31 Pox_MCEL Methyltransf_23 Methyltransf_12 MetW Methyltransf_29 AdoMet_MTase Methyltransf_5
Motif
Other DBs
NCBI-ProteinID: AZP04999
UniProt: A0A3Q9BLZ0
Position
2219892..2220743
Genome map
AA seq 283 aa AA seqDB search
MKKIERSGLFMKENLHLFQCPVCKQNFTDVVGTSVVCVENHQFDLSKKGTLHLLLKGGQN
EYDKKMLSSRKKLAETGFFQPMLDVVKKQLEGRNITALLDVGCGEGSHLHYLQNQGVSGT
KIGFDISKDAIQLAASHYFDDAFWCVADLAHSPFAGEQFDAILNILSPSHYEEFGRLLKK
GGVVVKVVPDADYLIELRQKLFMLEEEKQSYENEPVIKRFEQAYPNYLHEHVRYEVSLTA
EVYRWLLEMTPLTWGADEGKRLELLAEPLPSITVAMSVLVGIK
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaaattgagcgaagtggtttatttatgaaagaaaatctgcacttgttccaatgc
cccgtatgcaagcaaaattttacggatgtagtggggacaagtgtagtttgtgtggagaat
catcaattcgatttgtctaaaaaaggaacgctgcatcttttattaaaaggtggacagaat
gaatatgataaaaaaatgctgtcgagccgaaaaaaactggcagagactggcttttttcag
ccaatgctggacgtcgtaaaaaaacaattagagggaagaaatataacagcacttctagat
gtgggatgtggagaaggctctcacctacattatttacaaaatcagggagtatctggcact
aaaattggttttgatatttccaaagacgctattcagttggcagcctctcattattttgac
gatgcattttggtgtgtggctgatttggctcattctccatttgccggagagcagtttgat
gcgattttgaatattttatcgccatctcattatgaagagtttggtcgtctcttgaaaaaa
ggtggtgtagttgtcaaagtagttcccgatgcggattatttaattgagcttcgtcaaaaa
ttgtttatgctggaggaagaaaagcagagctatgagaacgaaccggtaatcaaacgtttt
gaacaagcatatccaaattacttacatgaacatgttagatatgaagtgtctcttacagca
gaagtttaccgctggttattagaaatgacgcctttaacgtggggagcagatgaagggaaa
cgactggaactcttggcagagccactaccatccattacagttgcgatgtctgtccttgta
ggtataaagtaa

DBGET integrated database retrieval system