KEGG   Jeotgalibaca sp. H21T32: EJN90_11770Help
Entry
EJN90_11770       CDS       T05782                                 

Gene name
gndA
Definition
(GenBank) NADP-dependent phosphogluconate dehydrogenase
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
jeh  Jeotgalibaca sp. H21T32
Pathway
jeh00030  Pentose phosphate pathway
jeh00480  Glutathione metabolism
jeh01100  Metabolic pathways
jeh01110  Biosynthesis of secondary metabolites
jeh01120  Microbial metabolism in diverse environments
jeh01130  Biosynthesis of antibiotics
jeh01200  Carbon metabolism
Module
jeh_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
jeh_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:jeh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    EJN90_11770 (gndA)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    EJN90_11770 (gndA)
Enzymes [BR:jeh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     EJN90_11770 (gndA)
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     EJN90_11770 (gndA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 F420_oxidored Shikimate_DH ApbA IlvN 2-Hacid_dh_C 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AZP05263
UniProt: A0A3Q9BLY0
Position
2531035..2532465
Genome map
AA seq 476 aa AA seqDB search
MTKQQIGVVGMAVMGKNLALNIESRGYSVSIFNRTGSKTEAVVAENPDKKLVPTYTIEEF
VDSLEKPRRILLMVKAGVATDKTIQSLLPHLDKGDVLIDGGNTFYQETIRRNKELENSGV
NFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILEQISAKAEDGTPCVTYIGSDGAGH
YVKMVHNGIEYGDMQLIAESYDLMRNFLKMSVEEIASVFKEWNEGELDSYLIDITADILT
KYDPETGKPMVDVILDRAGNKGTGKWTSQSALDLGVPLPLITESVFARFISAIKSERVAA
SKILPEPTETLPEVDKAEFLENIRKALYFSKIMSYAQGFSQMRFASEENDWNLQYGEIAK
IWRAGCIIRARFLQNITDAYEKNPELKNLLLDGYFINITKEYQQSVRKVVSTAVLAGLPV
PSLSSAIAYFDSYRSETLPANIIQAQRDYFGAHTYERTDKDGVYHFEWDEEIEVPQ
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgactaaacaacaaattggggttgtaggcatggctgtaatgggtaagaacttagccctc
aatattgaaagtagaggatactcagtatctatctttaaccgaactggatcaaaaacagaa
gcagttgttgctgaaaatcctgataaaaaactagttccaacatatacgattgaagagttt
gtagattcacttgaaaaaccaagaagaattttattaatggtaaaagcaggtgtagcaaca
gataaaaccattcaatcacttcttccgcacttagataaaggagacgtattaattgatgga
ggaaatactttctatcaagaaacgatccgtcgtaataaagaattagaaaattctggtgtg
aactttatcggaacaggcgtttctggtggagaagaaggtgcgctaaaaggaccttccatt
atgccaggcggacaaaaagaagcatatgaattagtagctcctattttagagcaaatctcc
gcaaaagcagaagacggtaccccgtgtgtgacttatattggcagcgatggtgctggacat
tatgtaaagatggtccacaacggtattgaatatggagatatgcaattaattgcagaatct
tatgacttaatgcgtaatttcctgaaaatgagcgtagaagagattgcttcagtcttcaaa
gagtggaatgaaggcgaacttgatagttacttgattgatattacagcagatattctaacg
aaatatgatcctgaaactggcaaaccaatggttgatgtcattctagatcgtgcaggaaac
aagggtactggtaaatggacttctcaaagtgcactagatttaggagtgccgttgccgttg
attactgaatcagtgtttgctcgttttatttcagcaatcaagtccgaacgtgttgcagca
agcaaaattctaccagaaccaacagaaactctaccagaagtggacaaagcagagttttta
gaaaatattcgtaaagccttatactttagtaaaatcatgagctatgctcaaggtttttct
caaatgcgttttgcaagtgaagaaaatgactggaatctacaatatggcgaaattgcaaaa
atttggagagcgggatgcattatccgtgctcggttcttacaaaacatcactgacgcatat
gaaaagaatccagaactgaagaatttgctgttagacggttattttataaatattacaaaa
gagtatcaacaatctgttcgtaaagtagtttctactgccgtgttagctggtttgccagtt
ccgtctctttcttccgcgattgcatactttgattcttatcgttcagagacattgccagca
aatatcattcaagcacaacgtgattactttggcgctcatacttatgaacgtacggataaa
gatggtgtttatcactttgaatgggatgaagaaatagaagttccgcaataa

DBGET integrated database retrieval system