KEGG   Jeotgalibacillus malaysiensis: JMA_19270Help
Entry
JMA_19270         CDS       T03570                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
jeo  Jeotgalibacillus malaysiensis
Pathway
jeo00670  One carbon pool by folate
jeo01100  Metabolic pathways
jeo01120  Microbial metabolism in diverse environments
jeo01200  Carbon metabolism
Module
jeo_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:jeo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    JMA_19270
Enzymes [BR:jeo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     JMA_19270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA AAA_26 GTP_EFTU_D2
Motif
Other DBs
NCBI-ProteinID: AJD91244
UniProt: A0A0B5AT93
Position
complement(1791908..1793593)
Genome map
AA seq 561 aa AA seqDB search
MTTNKTVPSDIDIAQTASMAPISEIAAGAGLTNEDIEMYGQFKAKIKFETINRLKTAKDG
KLILVTSINPTPAGEGKSTVTVGLADALKASGKNSMVALREPSLGPVMGVKGGATGGGYA
QVLPMEDINLHFTGDIHAITTANNALAAFIDNHIHQGNEQQIDPRRIIWKRVMDMNDRAL
RQIVIGLGGPARGVPREDGFDITVASEIMAVLCLSSDLHDLKNRLSNIVIAYTYQGEPVT
VADLDVQGALSLLLKDALKPNLVQTLEQTPALIHGGPFANIAHGCNSVLATKTALKLADY
VVTESGFGADLGAEKFLNIKTRTTEKHPDAVVIVATVRALKMHGGKSKKELVNEDTQALK
AGLTNLKKHIETIQEFGLPVVVAINKFHTDSDAEINILESFCKSEQVPFSLTEVWEKGGN
GGIDLAAKVIEAIENPGHFSYLYNLDLPIKEKINTIVRKVYGGSEAVFSKKAEAQIQQFE
SYGWGALPICMAKTQYSLSDDPSQYGRPEGFKVTIREIVPKLGAGFLVALTGDVMTMPGL
PKKPAAQNMDVTDDGKGIGLF
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgacgactaataaaactgtaccttcagatattgatattgcacagacagcttcgatggca
ccaatcagtgaaattgccgccggagcagggctgacgaatgaagacatagaaatgtatggt
cagttcaaagccaaaatcaagtttgaaacgatcaaccggttaaaaacggcaaaggatgga
aagttaattcttgtcacatccattaatccgactccagctggtgaaggaaaatcaacagta
acggttggactagcagatgcactcaaagcatccggaaagaattcaatggttgctttaaga
gagccttcacttggacctgtaatgggcgtaaaaggaggagcaacaggcggagggtatgca
caagtgctgccgatggaagatattaatcttcactttaccggtgatattcatgcaattaca
acggcaaataacgcattagctgcatttatagataatcatattcatcaggggaatgaacag
cagatcgatccaaggagaattatctggaaaagagttatggatatgaatgaccgcgcgctc
agacagattgtgatcggtcttggaggacctgctagaggtgtgccgagagaggatggtttt
gatattactgttgcctctgagatcatggcagtgctttgtctttcatcagatttacatgat
ctgaaaaaccgtttatcaaatattgtcattgcttatacttatcagggagagccggtgact
gttgctgaccttgatgtacagggggcattatcattacttctcaaagatgctttaaagcca
aatcttgtccagacgcttgaacagacacctgcgctgattcacggaggtccttttgcaaat
atcgcacatggctgtaattccgttctggctactaagacagctttaaagctggcagactat
gtagtcactgaatcaggttttggtgcagacctcggtgctgaaaagtttttaaatatcaaa
acaagaacaacagaaaaacatcctgatgctgtcgtgattgtagcaactgtacgtgcgctt
aaaatgcacggagggaagtctaaaaaagaattagtcaatgaagatacacaggcacttaaa
gcaggtttaaccaaccttaaaaaacatattgaaacaattcaggaatttggtctgcctgtc
gtggtcgcaattaataaattccatacagacagtgatgctgaaatcaatattcttgaatca
ttctgtaagagtgaacaagtaccattttcattaacagaagtatgggagaaaggtggaaat
ggcggaattgatcttgctgcaaaagtgattgaagcaattgaaaatccaggacacttttca
tacctttacaatcttgatctgccaataaaagaaaaaattaatacaattgtgaggaaagta
tacggcggttctgaagctgtattctctaaaaaggcagaagctcaaatccagcagtttgaa
tcctatggctggggtgctctgccaatctgtatggctaaaacacaatattcattatcagat
gatccctcgcaatatggtcgtcctgaaggttttaaagtgacaatcagagaaattgtacca
aagcttggcgcaggctttctggtcgctttaacgggtgacgtgatgacaatgccgggcctt
cctaaaaagccggctgcacaaaatatggacgttacagatgatggtaaaggtattggttta
ttttaa

DBGET integrated database retrieval system