KEGG   Jeotgalibacillus malaysiensis: JMA_20600Help
Entry
JMA_20600         CDS       T03570                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
jeo  Jeotgalibacillus malaysiensis
Pathway
jeo00030  Pentose phosphate pathway
jeo00480  Glutathione metabolism
jeo01100  Metabolic pathways
jeo01110  Biosynthesis of secondary metabolites
jeo01120  Microbial metabolism in diverse environments
jeo01130  Biosynthesis of antibiotics
jeo01200  Carbon metabolism
Module
jeo_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
jeo_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:jeo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    JMA_20600
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    JMA_20600
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:jeo04147]
    JMA_20600
Enzymes [BR:jeo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     JMA_20600
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     JMA_20600
Exosome [BR:jeo04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   JMA_20600
  Exosomal proteins of colorectal cancer cells
   JMA_20600
  Exosomal proteins of bladder cancer cells
   JMA_20600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AJD91377
UniProt: A0A0B5ARV4
Position
1907785..1909278
Genome map
AA seq 497 aa AA seqDB search
MKQTSTPPTLIMIFGATGDLAKRKLYPSLYQLYLKGSLEKQFAVLGIGRREWTNDQFIQH
IRDSLTQASSNHDEIESFIEHCVYESHDVEDSSSYIKLKDKANELDEKFDLKGNRIFYLA
MAPEFFGTITDHLKADGLTDNDGFCRLVIEKPFGHNLPSANALNDQIRQSFPEESIYRID
HYLGKEMVQNIEVIRFANALFEPLWNSRFISNIQITSSEVLGVEERGRYYEKSGALRDMV
QNHMLQMVALLAMEPPISLSTDEIRSEKVRALRSLRSIEGSEVDDYFVRGQYGPDHKGEQ
KGYRDNANVNPESNTETYVAGKVMIDNFRWAGVPFYIRTGKSMAVKSTKIVVQFKDIPMN
LYYNKEHSLDPNLLVIHIQPDEGITLHLNAKKTAQGIDTDSVKLSYSASSIDGINTPEAY
EKLLLDCILGDATNFTHWDEVRHSWSFVDKISDHWEKTQDKTFPNYFAGSMGPERSDWLL
EKDGFEWWPIGELDVEE
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacagacatctacacccccaacattaattatgatttttggcgcaaccggagacctt
gctaaacgcaaattgtacccttcattatatcagctttatctgaaaggtagcttagaaaaa
caatttgcagtgcttggtatcggacggcgtgaatggacaaatgatcagttcatacagcac
attcgcgattccttaacacaagcctcaagtaatcatgacgagattgagtcgtttattgag
cattgtgtttatgagtcacatgatgtggaagattcctcatcatacataaaactaaaagat
aaagcgaatgaattagatgagaagtttgatctaaaaggaaacagaatcttttatctggca
atggcaccggaatttttcggtacgattacagatcatttaaaagctgatggtctgactgat
aatgatggattctgccgactggtaattgaaaaaccgtttggtcataacctgccatctgct
aatgcattaaatgatcagatcagacaatccttcccggaagagtcaatttaccggattgat
cattacctcggaaaagaaatggtacagaatattgaggtcatccgttttgccaatgcttta
ttcgagcctttgtggaacagccgtttcatttcaaatatccagattacatcctctgaggtt
cttggtgttgaagaacgtggccggtattatgaaaaaagtggtgctttaagagatatggta
caaaaccacatgcttcaaatggtggcactgcttgcaatggaaccgccaatcagcctgagc
acagatgagatcaggagtgaaaaagtccgcgctttacgctcgcttcgctcaattgagggc
agtgaagtggatgactatttcgtcagagggcaatatggtcctgatcataagggtgaacaa
aaaggctatcgcgataatgcgaatgtgaaccctgagtctaatactgaaacgtatgtagcc
ggtaaagttatgattgacaacttccgctgggcaggcgtaccgttttatatccgcacagga
aaaagcatggcagttaaatcaacaaaaatcgtagtccagttcaaagatatccctatgaac
ctttactacaataaagaacattcccttgatccaaaccttcttgtcattcacattcagcct
gatgaaggcatcacgctgcatctgaatgcgaagaaaacggctcagggaatcgatacagac
agcgttaagttaagttactcagcaagcagtattgacggtattaacacgcctgaagcctac
gaaaagctgttactggattgtattcttggtgatgcgacaaactttacacattgggatgag
gttaggcattcatggagctttgtagataagatctctgatcactgggaaaaaacgcaggat
aaaacattcccgaattactttgcaggttcaatgggacctgaaagaagcgactggctactt
gaaaaagacggctttgaatggtggccgatcggtgagcttgatgtagaagaataa

DBGET integrated database retrieval system