KEGG   Jeotgalibacillus malaysiensis: JMA_35120Help
Entry
JMA_35120         CDS       T03570                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
jeo  Jeotgalibacillus malaysiensis
Pathway
jeo00020  Citrate cycle (TCA cycle)
jeo00620  Pyruvate metabolism
jeo01100  Metabolic pathways
jeo01110  Biosynthesis of secondary metabolites
jeo01120  Microbial metabolism in diverse environments
jeo01130  Biosynthesis of antibiotics
jeo01200  Carbon metabolism
Module
jeo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
jeo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:jeo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    JMA_35120
   00620 Pyruvate metabolism
    JMA_35120
Enzymes [BR:jeo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     JMA_35120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AJD92829
UniProt: A0A0B5AXW6
Position
complement(3330453..3331988)
Genome map
AA seq 511 aa AA seqDB search
MSNKHIKSDVILIGAGIMSATLGSLLKELAPDWNIKAFERLDSAGEESSNEWNNAGTGHS
SLCELNYTNELPDGTIDVTKANKVNEEFQVSKQFWAHLVNSGLIKNPKEFIMALPHMSLV
HGEKDVNFLKNRFKALSDNPLFSGMEYSDDPEKLKEWIPLIMENRQVNQPIAATKIDAGT
DVNFGALTRKLFAHLAEEGVSVNYKHQVDDMTRTEDGEWELKIRDLKNDRLEYHKAKFVF
IGAGGGSLHLLQKSGIPESKNVGGFPVSGLFMVCKKPEIVEKHYAKVYGKAPVGAPPMSV
PHLDTRLIDGKESLFFGPFAGFSPKFLKTGSNMDLITSVKKDNLTTMVSAGLKNMPLTKY
LIEQVLQSKEQRMEALREFVPNANSDDWELVVAGQRVQVIKDTKQGGKGTLQFGTEVISG
ANGSIAALLGASPGASTSVSVMLDVLSRCFPEEMKGWEPKIKEMIPSYGKNLLEHPDLIK
EINETTSEALGLVNAGAAIAEDPIKAETTTV
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacaaacatattaaatcagacgttatcttaattggtgccggtattatgagtgca
acgcttggatctttgctgaaggaactggcgccggattggaatataaaagcttttgaacgg
cttgacagtgcaggcgaagagagctcaaatgaatggaataatgcaggaacaggccattca
tctttatgtgaattgaattatacaaatgaattgccagatggcacgattgatgtaacaaaa
gcgaataaggttaacgaggaatttcaggtttccaaacagttttgggcgcatcttgttaat
agcggcctgattaaaaacccgaaggaattcatcatggcacttcctcatatgagtcttgtt
catggtgaaaaagatgttaattttttaaaaaaccgatttaaagcgctttcagataatcca
ttgttttccggtatggagtattcggatgatccggagaagctgaaggaatggatcccgtta
attatggaaaatcgccaagtgaaccagccgatcgcagctacaaaaattgatgctggaaca
gatgtgaatttcggcgcgctaacacgtaagttattcgctcatttagcagaagaaggcgtt
tcagttaattataagcatcaggttgacgatatgacgcgtactgaagatggtgaatgggaa
ctgaaaatccgcgatctcaaaaacgatcgtcttgagtatcataaggcgaagtttgtcttt
attggcgcaggtggcggaagtctgcatctgcttcagaaatcaggtattcctgaaagtaaa
aatgttggcggattcccggttagcgggttgttcatggtgtgtaaaaagcctgaaatcgtt
gagaagcactatgcgaaagtgtacgggaaagcaccggttggcgcaccgccaatgtccgtg
cctcaccttgatactcgcctgattgacgggaaagagtcgttattttttggaccgtttgca
ggcttttcaccaaagtttttaaagacaggttcgaatatggacctgattacttcagtaaaa
aaggacaacctgacaacaatggtttcagcaggcttgaaaaatatgccgctgacaaagtat
ttgattgagcaggtgctgcaatccaaggaacagcgtatggaagcgctgcgtgaatttgta
ccgaatgcaaacagtgacgactgggagcttgttgtagccggccagcgtgtgcaggtgatt
aaggatacgaaacagggtggaaaagggacgcttcagtttggaacggaggtcatcagcggc
gcaaatggatcaattgctgcactgctgggcgcttcaccgggcgcttctacatcagtatcc
gttatgctcgatgtactgagccgctgtttccctgaggaaatgaaaggatgggagcctaag
atcaaagagatgattccttcttacggaaaaaatctgcttgagcatcctgacttaattaaa
gaaattaacgagacgacttcagaagcgcttggcctggtaaatgccggtgctgcgattgct
gaagatccaattaaagctgagacaacaactgtatga

DBGET integrated database retrieval system