KEGG   Jeotgalibaca sp. PTS2502: BW721_00570Help
Entry
BW721_00570       CDS       T04689                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
jep  Jeotgalibaca sp. PTS2502
Pathway
jep00071  Fatty acid degradation
jep00072  Synthesis and degradation of ketone bodies
jep00280  Valine, leucine and isoleucine degradation
jep00310  Lysine degradation
jep00362  Benzoate degradation
jep00380  Tryptophan metabolism
jep00620  Pyruvate metabolism
jep00630  Glyoxylate and dicarboxylate metabolism
jep00640  Propanoate metabolism
jep00650  Butanoate metabolism
jep00900  Terpenoid backbone biosynthesis
jep01100  Metabolic pathways
jep01110  Biosynthesis of secondary metabolites
jep01120  Microbial metabolism in diverse environments
jep01130  Biosynthesis of antibiotics
jep01200  Carbon metabolism
jep01212  Fatty acid metabolism
jep02020  Two-component system
Brite
KEGG Orthology (KO) [BR:jep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BW721_00570
   00630 Glyoxylate and dicarboxylate metabolism
    BW721_00570
   00640 Propanoate metabolism
    BW721_00570
   00650 Butanoate metabolism
    BW721_00570
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BW721_00570
   00072 Synthesis and degradation of ketone bodies
    BW721_00570
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BW721_00570
   00310 Lysine degradation
    BW721_00570
   00380 Tryptophan metabolism
    BW721_00570
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BW721_00570
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BW721_00570
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BW721_00570
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:jep04147]
    BW721_00570
Enzymes [BR:jep01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BW721_00570
Exosome [BR:jep04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BW721_00570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SBDS_C
Motif
Other DBs
NCBI-ProteinID: APZ48298
UniProt: A0A1U7E977
Position
119012..120226
Genome map
AA seq 404 aa AA seqDB search
MEKVYIVGAKRTPIGSFLGSLKDVSAGDLGSVAIKAALEESKVHVTDVDEVLMGNVLSAG
QGQGIARQTAIKAGLGVRVPATALNIACGSGMKAVMNALQAIRAEDAHVIVAGGVESMSQ
TPHLIPGRNRSGHKMGNFEVVDHMLHDGLTDAFEGYHMGITAENIVEKYQITREEQDKFA
FESQQKAIAAIDAGKFKAEIAAVEVINRNGKVVVDQDEYPNRQTNLDKLAQLRPAFKKGG
SVTAGNASGINDGASATVVVSESYLKNNNIQPLVEIVAVAQAGVDPSVMGLGPTPAVEKV
LEKAQLTLADIDVIELNEAFSSQALGVIHELSERCAIDRAELMAKTNLNGGAIALGHPIG
ASGNRIIVTLIHLMKEKKAKYGLATLCIGGGMGTAIILKNPTID
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaggtatatattgtgggagcgaaacgaacaccgattgggtcttttttaggctct
ttgaaagatgtttcagcaggtgatttaggaagtgtagcaattaaggctgccttagaagaa
agtaaggttcacgtaactgatgttgatgaagtgctgatggggaatgtattatcggctggg
caaggacaaggcatcgcgagacaaactgccattaaagctggcttaggagtcagagttcca
gccactgcattaaatattgcttgtgggagtggcatgaaagcagttatgaatgctcttcag
gccattcgagcggaagacgctcatgtgattgttgcaggtggtgttgaatcaatgagtcaa
acgcctcatcttattccgggacgcaaccgtagcggtcacaaaatgggtaattttgaagta
gtcgaccatatgttgcacgatggtctaacagatgccttcgaaggttatcatatgggtatc
actgctgagaatatcgttgagaaataccaaattacaagagaagaacaagataaatttgct
tttgaatcgcaacaaaaagcaattgcagctatagatgctggaaaatttaaagcagaaata
gcagccgttgaagtgatcaatagaaatgggaaagttgttgtcgatcaagatgagtatcca
aaccgccaaacaaatttggataagctggcacaattacgccctgcatttaaaaagggtggt
agtgtaactgccggaaatgcttctggtattaatgacggtgccagcgcaactgttgtggtg
agcgagagctacttgaaaaataacaatattcaaccattagttgaaattgttgcagtagct
caagccggtgttgacccatcagttatggggttaggtccaacaccagccgttgaaaaagta
ttggaaaaagcacaattaacattggctgatattgatgtcattgaattaaacgaagccttt
tcttctcaagcattaggtgtaattcatgaattatcagaacgttgtgcaattgatagagca
gagcttatggctaaaacaaatctaaatggtggagccattgccttgggtcatccaattgga
gcaagtggtaatcgaattattgtgactttgatccatttgatgaaagaaaaaaaagctaaa
tacggtttagcaacgctctgtatcggtggcggaatgggaaccgcaattattcttaaaaac
ccaaccattgactaa

DBGET integrated database retrieval system