KEGG   Jeotgalibaca sp. PTS2502: BW721_04690Help
Entry
BW721_04690       CDS       T04689                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
jep  Jeotgalibaca sp. PTS2502
Pathway
jep00430  Taurine and hypotaurine metabolism
jep00620  Pyruvate metabolism
jep00640  Propanoate metabolism
jep00680  Methane metabolism
jep01100  Metabolic pathways
jep01120  Microbial metabolism in diverse environments
jep01200  Carbon metabolism
Module
jep_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:jep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BW721_04690
   00640 Propanoate metabolism
    BW721_04690
  09102 Energy metabolism
   00680 Methane metabolism
    BW721_04690
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    BW721_04690
Enzymes [BR:jep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     BW721_04690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: APZ49036
UniProt: A0A1U7EBE6
Position
complement(966071..967264)
Genome map
AA seq 397 aa AA seqDB search
MSKIIAINAGSSSLKFTLYQMPEEDVISTGIIERIGLKDSIFTIKYGEGKKYSVTEDIDN
HEIAVEKLMTQLAELGIITDFNEITGVGHRVVAGGEDFKESALIDDEALAKIEALGELAP
LHNPANATGIRAFKKLLPEITSVAVFDTAFHAHMPAVNYLYSIPMEYYEDFAARKYGAHG
TSHQYVSQRAAELLGKPLEDLKIITCHLGNGASITAVDGGKSIDTSMGFTPLAGLTMGTR
SGDIDASLLPYLMNKLEITDINEMVDILNKKSGLLGLSGVSSDMRDVESKAEAGDERSQL
ALDIFYNRVQKYIGQYIATMNGVDAIVFTAGIGENSAMTRKILIDGISWFGCDIDDERNN
VRGEERIISTDAAKVQVLLIPTDEEKVILNDVVRLSK
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaattattgcaattaacgctggaagttccagtctgaaatttactttataccaa
atgccagaagaagacgttatttcaacaggtattattgagagaattggtttgaaagattct
attttcacaattaaatatggtgaaggtaaaaagtattccgttacagaagatattgataac
catgaaattgctgttgagaaattaatgactcaattggcagaactaggaattatcacagac
tttaacgaaatcactggcgttggacatcgtgttgtagctggtggagaagacttcaaagaa
tcagcattaattgatgacgaagctcttgctaaaattgaagcattaggtgaattagcacca
ttgcacaaccctgcaaatgcaacaggaattcgtgccttcaaaaaattattaccagaaatt
acaagcgtagctgttttcgatacagctttccatgcgcacatgccagctgtaaactaccta
tacagcattccgatggagtactatgaagatttcgctgcacgtaagtacggtgctcacgga
acaagccaccaatacgtttctcaacgcgcagctgagttattaggcaaaccactcgaagac
ttgaaaatcattacatgtcacttaggtaacggtgcgtctattactgcagtagatggtgga
aaatcaatcgatacatctatgggattcacaccactagctggtcttacaatgggaactcgc
tctggtgacatcgatgcgtcattattaccctacttgatgaataaacttgaaattactgat
attaatgaaatggttgatatcttaaataaaaaatcaggtttactaggtctttcaggtgta
tcaagtgatatgcgcgacgttgaaagtaaagctgaagctggtgatgagcgttcacaacta
gcattggatattttctacaatcgggttcaaaaatacattggtcaatacattgcaacaatg
aacggtgttgatgcgattgtcttcactgctggtattggtgaaaactctgctatgactcgt
aaaatccttatcgacggtattagctggttcggttgtgatattgacgatgaaagaaacaat
gttcgtggagaagaaagaatcatctcaacagatgctgctaaagtacaagttcttcttatt
ccaacagatgaagaaaaagttatcttaaatgacgttgttcgtttaagcaaataa

DBGET integrated database retrieval system