KEGG   Jeotgalibaca sp. PTS2502: BW721_06550Help
Entry
BW721_06550       CDS       T04689                                 

Definition
(GenBank) arginine--tRNA ligase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
jep  Jeotgalibaca sp. PTS2502
Pathway
jep00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:jep00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BW721_06550
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:jep01007]
    BW721_06550
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:jep03016]
    BW721_06550
   03029 Mitochondrial biogenesis [BR:jep03029]
    BW721_06550
Enzymes [BR:jep01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     BW721_06550
Amino acid related enzymes [BR:jep01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   BW721_06550
Transfer RNA biogenesis [BR:jep03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BW721_06550
 Prokaryotic Type
   Other AARSs
    BW721_06550
Mitochondrial biogenesis [BR:jep03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BW721_06550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1d DALR_1 Arg_tRNA_synt_N Fe_dep_repr_C Retrotrans_gag
Motif
Other DBs
NCBI-ProteinID: APZ49367
UniProt: A0A1U7ECI8
Position
complement(1336749..1338440)
Genome map
AA seq 563 aa AA seqDB search
MDYKLLIAKEIHHHVAEYLTEEAVYNLLENPKHDDHGDVAFPAFALAKALRKAPPMIASE
LAEKMNHPFIEKVQTVGPYLNFFLNKSEISAAVLKEIASKKEAFGNATVGEGKTVPIDMS
SPNIAKPISMGHLRSTVIGNALANIVEKVGYQPVKINHLGDWGTQFGKLIVAYKKWGNEA
DVKADPIAQLLKLYVHFHEVAEEETELEDEAREWFKKLEDGDQEANELWKWFRKESLKEF
MKIYDMLDIDFDSFNGEAFYNDKMDEVVQLLEEKNLLTTDRGATIVDLEKYNLNPALIKK
SDGATLYITRDLAAAIYRKRTYDFALSLYTVGNEQSNHFKQLKAVLTEMGYDWADDMHHI
PFGLITQGGKKLSTRKGKIILLEEVLNEATNLAMAQINEKNPSLEDKEEVAKQVGIGAVI
FHDLKNDRLNNFDFVLEEVVQFEGETGPYVQYTNARALSILRKAAVELDLDQPLSLSDDY
AWDVIKLINSFPDVVMTAFEKFEPSVIAKYALHLSQAFNKYYGNTRILNDDAEKNARLVL
VKATTVILQESLRLLGVKAPNKM
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atggattataaattattaattgcaaaagaaattcaccaccatgttgctgagtatttaaca
gaagaagctgtttataacttactagaaaaccctaaacatgatgatcatggggatgtggct
ttcccagctttcgccttagcgaaagcattgcgcaaagcaccaccaatgattgcgagtgaa
ctagcagagaagatgaaccacccatttattgaaaaagtacaaactgtaggaccttactta
aactttttcttaaataagagtgaaattagtgcagctgttctaaaagaaatcgctagcaaa
aaagaagcattcggtaatgcaacagtaggggaaggcaagacagttccgattgatatgtca
tcaccaaatatcgcgaagccaatttcaatggggcacttgcgttcaacagttatcggtaat
gcattagctaatattgttgaaaaagttggttaccaaccggttaaaattaaccacttgggt
gactggggaacacaatttggtaagttgattgtggcatacaaaaaatggggaaatgaagcg
gatgttaaagctgaccctatcgcacaactattgaaactttacgttcactttcacgaagtt
gcagaagaagaaacagagttggaagacgaagcgcgtgaatggttcaagaaactagaagac
ggcgaccaagaagcgaatgaactatggaaatggttccgcaaagagtcattaaaagagttc
atgaaaatctacgatatgcttgatatcgatttcgattcatttaacggagaagcattctac
aacgataaaatggatgaagtggttcaattactagaagagaaaaaccttctaacgactgac
cgtggtgcaacaatcgttgatttagagaaatacaacttgaatcctgccttgattaagaag
agcgacggcgcaacgctatacattacacgtgatttagcggctgcgatttaccgtaaacgt
acatacgactttgctttgtctttatatacagtgggtaacgagcaatcaaaccacttcaaa
caattgaaggctgttctaacggagatgggctatgattgggcagatgatatgcaccacatt
ccattcggtttgattacacaaggcggtaagaaactatctacgcgtaaaggtaaaattatt
ttactagaagaagtgttgaatgaggcaacaaacttggctatggctcaaattaatgagaaa
aacccaagccttgaagataaagaagaagtagctaaacaagttggtattggcgctgttatc
ttccacgatcttaaaaatgatcgcttaaataactttgactttgttttagaagaagtggtg
caatttgaaggggagactggtccttacgtacaatatactaacgctcgtgcgttaagtatc
ttgcgtaaagccgcggttgaacttgatcttgaccaaccactaagcttgagtgacgattat
gcgtgggacgtgattaaattaattaacagcttcccagatgtagttatgacagccttcgaa
aaattcgagccatcagtgattgctaagtacgctttacacttatcacaagcctttaacaaa
tactacggtaacacacgtattttaaatgatgatgcagaaaagaatgctcgtcttgtatta
gttaaagcaacaacagttattttacaagaaagcttacgtctactaggcgttaaggcacca
aataaaatgtaa

DBGET integrated database retrieval system