KEGG   Jeotgalibaca sp. PTS2502: BW721_07790Help
Entry
BW721_07790       CDS       T04689                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
jep  Jeotgalibaca sp. PTS2502
Pathway
jep00480  Glutathione metabolism
jep00590  Arachidonic acid metabolism
jep01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jep00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    BW721_07790
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BW721_07790
Enzymes [BR:jep01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BW721_07790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: APZ49580
UniProt: A0A1U7ECV0
Position
complement(1587816..1588286)
Genome map
AA seq 156 aa AA seqDB search
MGIYDISVTAENGESYQLDRYKGKTMLIVNTATKCGLATQFDELQALYEKYSEQDFVVLG
FPSNQFKQEVSSANEAAEACRLTYGVSFPMHDIVTINGKGAHPLFQLLTEETKGILGSAI
KWNFTKFLVDKNGTIVKRFGPKDTPRSFEKEIEEYL
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgggaatttatgatatttcagttactgcagaaaatggcgaaagctatcaattagaccgc
tacaaaggaaaaacaatgctaatcgtaaataccgcaacgaaatgcggcttggcaacgcaa
ttcgatgaattacaagctttatatgaaaaatatagtgaacaagattttgtcgtattgggc
tttccatcaaatcaattcaagcaagaagttagctctgccaacgaagctgccgaggcttgc
cgcttaacgtatggggtatcgttccctatgcacgatattgtgacgattaacggtaaaggc
gcccatccgttatttcaattactaacagaagaaacaaaaggaatcttaggcagtgcgatt
aaatggaattttactaaattcctagtcgataaaaatggcactatcgttaaacgctttgga
ccaaaagacacaccaagatcatttgaaaaagaaattgaagagtacctatag

DBGET integrated database retrieval system