KEGG   Jeongeupia sp. USM3: BJP62_00275Help
Entry
BJP62_00275       CDS       T04552                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
jeu  Jeongeupia sp. USM3
Pathway
jeu00450  Selenocompound metabolism
jeu00970  Aminoacyl-tRNA biosynthesis
jeu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jeu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BJP62_00275
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BJP62_00275
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:jeu01007]
    BJP62_00275
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:jeu03016]
    BJP62_00275
Enzymes [BR:jeu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BJP62_00275
Amino acid related enzymes [BR:jeu01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BJP62_00275
Transfer RNA biogenesis [BR:jeu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BJP62_00275
 Prokaryotic type
   Other AARSs
    BJP62_00275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AOX99023
UniProt: A0A1D9B9C9
Position
complement(57427..59472)
Genome map
AA seq 681 aa AA seqDB search
MSRKILVTSALPYANGAIHLGHLVEYIQTDIWVRFQKMRGHTCHYVCADDTHGTPIMLRA
EKEGISPEALIERVHGEHLRDFTGFHVAFDNFYTTNSEENREYAYRIYNTLKQNGKIANR
TISQLYDPVKNMFLPDRFVKGECPKCAAKDQYGDNCEVCGTTYSPTELKNPYSAVSGATP
VLRDSEHYFFRLGDCEAFLRDWTRGSVTVAGQARPRLQEGAANKMQEWFDAGLSDWDISR
DAPYFGFEIPDAPGKYFYVWLDAPVGYMASHKNLCDRLGLDFDEYWSKDSDAELYHFIGK
DILYFHALFWPAMLEFGGYRTPTGINAHGFLTVDGAKMSKSRGTFITAESYLRHLNPEWL
RYYFAAKLNSAIEDIDLNLEDFAARVNSDLIGKYVNIASRAAGFISKRFGGELARNLGDA
PVLAKLQAAGDELAQLFEAREYSRAIRDIMALTDEVNQFVDAHKPWEMAKQEGMDAELQR
VCSILINAFRLLTIYLKPVLPKLAFEVEAFLNIAPLRWVDAGSLLLAHCINPYSHLMTRI
DPKAVEAMVEENRQSLAPAAETRPALDYEVPPISETISIDDFMKVDLRIAKIVEAKSVEG
ADKLVSLTLDIGNETRHVFAGIKSAYKPEELQGRLTVMAANLAPRKMKFGVSEGMVLAAG
GDGGLYILGPDSGAKPGMRVK
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcaagatcctcgtcacctccgccctgccctacgccaacggcgccatccacctc
ggtcacctggtcgaatacatccagaccgacatctgggtccgtttccagaagatgcgcggc
cacacctgccactatgtctgtgccgacgacacccacggcacgccgatcatgctgcgcgcc
gaaaaggaaggcatcagccccgaggcgctgatcgagcgcgtgcatggcgaacacctgcgt
gacttcaccggcttccatgtcgcgttcgacaatttctacacgacgaactcggaagaaaac
cgcgaatacgcataccggatctacaacacgctcaagcagaacggcaagatcgccaaccgg
acgatcagccagctgtacgacccggtcaagaacatgttcctgccggaccgcttcgtgaag
ggcgaatgcccgaagtgtgccgccaaggaccagtacggcgacaactgcgaagtctgcggc
accacctacagcccgaccgaactgaagaatccgtattcggcggtctccggtgcgacgccg
gtgctgagggattccgagcattacttcttcaggcttggcgactgcgaggccttcctgcgc
gactggacccgcggcagcgtcaccgtggccggccaggcccgcccgcggctgcaggaaggc
gcagcgaacaagatgcaggaatggttcgatgccggcctgtcggactgggacatctcgcgc
gacgcaccgtacttcggcttcgagatccccgatgcgccgggcaagtacttctacgtctgg
ctcgatgcgccggtcggctacatggccagccacaagaacctgtgcgaccgcctcggcctc
gacttcgacgaatactggagcaaggattcggacgccgagctctatcacttcatcggcaag
gacatcctctatttccacgcgctgttctggccggcgatgctcgagttcggcggctaccgc
acgccgaccggcatcaatgcccacggtttcctgaccgtcgacggcgccaagatgagcaag
agccgcggcaccttcattaccgccgaatcgtacctgcgccacctgaaccccgagtggctg
cgctactacttcgccgccaagctcaacagcgcgatcgaggacatcgacctcaacctcgaa
gacttcgccgcgcgcgtcaacagcgatttgatcggcaagtacgtcaacatcgccagccgc
gccgccggcttcatcagcaagcgcttcggcggcgagctggcacgcaacctcggcgatgcg
ccggtgctggccaaactgcaggccgccggtgacgagctggcccagctgttcgaggcacgc
gaatacagccgggcgatccgcgacatcatggcgctgaccgacgaggtcaaccagttcgtc
gatgcgcacaagccgtgggaaatggccaagcaggaaggcatggacgccgagctgcagcgc
gtgtgctcgatcctgatcaacgccttccggctgctgacgatctacctcaagccggtactg
ccgaagctggcctttgaggtcgaggccttcctcaatatcgcgccgctgcgctgggtcgat
gccggttcgctcctacttgcgcactgcatcaatccgtattcgcacctgatgacgcggatc
gacccgaaggcggtcgaggccatggtcgaggaaaacaggcagagcctcgcaccggcagcc
gaaaccaggccggcactcgattacgaggtaccgccgatttccgagacgatcagcatcgac
gacttcatgaaggtcgacctgcgtattgcgaagatcgtcgaggccaagtcggtcgagggt
gccgacaagctcgtgtcgctgacgctcgacatcggcaacgagacgcgccacgtgtttgcc
ggcatcaagtcggcgtacaagcccgaggagctgcagggcaggctaacggtgatggccgcc
aatcttgcgccgcgcaagatgaagttcggcgtctcggagggcatggtgctcgccgccggc
ggcgacggcggcctgtacatcctcggcccggacagcggtgccaagccgggcatgcgcgtc
aagtaa

DBGET integrated database retrieval system