KEGG   Jeongeupia sp. USM3: BJP62_02375Help
Entry
BJP62_02375       CDS       T04552                                 

Definition
(GenBank) 5'/3'-nucleotidase SurE
  KO
K03787  5'-nucleotidase [EC:3.1.3.5]
Organism
jeu  Jeongeupia sp. USM3
Pathway
jeu00230  Purine metabolism
jeu00240  Pyrimidine metabolism
jeu00760  Nicotinate and nicotinamide metabolism
jeu01100  Metabolic pathways
jeu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:jeu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BJP62_02375
   00240 Pyrimidine metabolism
    BJP62_02375
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BJP62_02375
Enzymes [BR:jeu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     BJP62_02375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SurE
Motif
Other DBs
NCBI-ProteinID: AOX99402
UniProt: A0A1D9BAI6
Position
complement(530528..531271)
Genome map
AA seq 247 aa AA seqDB search
MRILISNDDGYFAPGLAALAGALAEHHDVLVCAPERDRSGASNSLTLDRPLTVRTAPNGF
RYVNGTPTDCVHLAATGLMETLPDMVVSGINHGANMGDDTIYSGTVAAATEGFLLGVPSM
AVSLASRNPAHFETAARVAVELAARIERDPFRGAVLLNVNVPDLPYEALAGHRVTRLGRR
HRAAPVIKSANPRGEAIWWVGPPGLAADAAEGTDFDAIAQGLVSITPLSIDLTAYPQLDF
IESWLHA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatactaatatcaaacgacgacggttatttcgcgccgggcctggccgcgctggct
ggcgcactggccgagcatcacgacgtgctcgtctgcgcaccggagcgcgatcgcagcggt
gccagcaactcgctgacgctcgaccggccgctgacggtgcgtaccgcgccgaacggtttc
cgctatgtcaacggcaccccgaccgactgtgtccacctcgccgcgaccgggctgatggaa
acgctgcccgacatggtggtgtccggcatcaaccacggcgccaacatgggcgacgacacc
atctattccggcaccgtcgccgcggcaacggaaggcttcctgcttggcgtgccttcgatg
gcggtgtcgctggcttcgcgcaacccggcccacttcgaaacggccgccagagtcgcggtc
gaactggctgcacgcatcgaacgcgacccattccggggtgcggtactgctcaacgtcaac
gtgccggatctgccgtacgaagcactcgccggccaccgggtcacgcgactcggccgccgg
catcgtgcggcgccggtgatcaagtccgccaatccccgcggcgaggcgatctggtgggtc
ggcccgcccggactcgccgccgatgcggcggaaggcaccgattttgacgcgattgcccaa
gggcttgtgtcgatcacgccgctgtcgatcgacctgaccgcttaccctcagctggatttc
atcgaatcatggctgcacgcatga

DBGET integrated database retrieval system