KEGG   Jeongeupia sp. USM3: BJP62_03585Help
Entry
BJP62_03585       CDS       T04552                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
jeu  Jeongeupia sp. USM3
Pathway
jeu00071  Fatty acid degradation
jeu00072  Synthesis and degradation of ketone bodies
jeu00280  Valine, leucine and isoleucine degradation
jeu00310  Lysine degradation
jeu00362  Benzoate degradation
jeu00380  Tryptophan metabolism
jeu00620  Pyruvate metabolism
jeu00630  Glyoxylate and dicarboxylate metabolism
jeu00640  Propanoate metabolism
jeu00650  Butanoate metabolism
jeu00900  Terpenoid backbone biosynthesis
jeu01100  Metabolic pathways
jeu01110  Biosynthesis of secondary metabolites
jeu01120  Microbial metabolism in diverse environments
jeu01130  Biosynthesis of antibiotics
jeu01200  Carbon metabolism
jeu01212  Fatty acid metabolism
jeu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:jeu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BJP62_03585
   00630 Glyoxylate and dicarboxylate metabolism
    BJP62_03585
   00640 Propanoate metabolism
    BJP62_03585
   00650 Butanoate metabolism
    BJP62_03585
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BJP62_03585
   00072 Synthesis and degradation of ketone bodies
    BJP62_03585
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BJP62_03585
   00310 Lysine degradation
    BJP62_03585
   00380 Tryptophan metabolism
    BJP62_03585
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BJP62_03585
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BJP62_03585
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BJP62_03585
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:jeu04147]
    BJP62_03585
Enzymes [BR:jeu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BJP62_03585
Exosome [BR:jeu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BJP62_03585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AOX99616
UniProt: A0A1D9BAY7
Position
complement(784130..785308)
Genome map
AA seq 392 aa AA seqDB search
MTDIVIVAAQRTALGNFGGALAKVAAPELGATVIRALLEKTGLAADQVSEVILGNVLTAG
LGQNPARQALRLAGLPDATPGLTINQVCGSGLKAVALGLQAILSGESDIVIAGGQENMSA
TPHILPGSRDGFRMGNAQLVDTMVYDGLTDVYNKYHMGVTAENIAKKYGISRTEQDELAL
SSQQKAAAAQAAGRFADEIVPVTIPQKKGDPVVFAADEFIKTNATMEGLAKLRPAFDKEG
TVTAGNASGINDGAAAVLLMTREKAEALGLKPLATIRAAASAGVEPSLMGMGPVPATQRV
LARTGWKLDDLDLIEGNEAFAAQALGVARELKWDWNRVNVNGGAIALGHPIGASGARILV
TLLHEMIRRDAKKGLATLCIGGGMGVALAVER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacatcgttatcgtcgctgcacaacggaccgcgctgggcaatttcggcggcgcg
ctggccaaggtggccgcgcctgaactcggcgcgaccgtgattcgtgcgttgctggaaaaa
accggccttgccgccgatcaggtcagcgaggtcatcctcggcaacgtgctgaccgccggc
ctcggccagaacccggcccgtcaggcactgcgccttgcagggctgccggacgcaacgccg
ggactgacgatcaatcaggtctgcggttcgggcctgaaggccgtcgcgctcggcctgcag
gcgatcctgtcgggcgagtccgacatcgtcatcgcaggcggccaggaaaacatgagcgcg
acgccgcacatcctgccgggttcgcgcgacggcttccgcatgggcaacgcgcaactggtc
gacacgatggtctacgacggcctgaccgatgtgtacaacaagtaccacatgggtgtgacc
gccgagaacatcgccaaaaagtacggcatcagccggaccgagcaggacgaactggcactg
tcgtcgcagcaaaaggccgccgccgcccaggcagcgggccgctttgccgatgaaatcgtt
ccggtgacgattccgcagaagaagggcgacccggtcgtgttcgccgccgacgagttcatc
aagaccaatgcgacgatggaaggtctggccaagctgcgcccggccttcgacaaggaaggc
acggttaccgccggcaacgcgtcgggcatcaacgacggcgccgctgcggtgctgctgatg
acgcgcgagaaggccgaggcgctcggcctcaagccgctggcgacgatccgtgccgccgcg
tcggccggtgtcgaaccgagcctgatgggcatggggccggtgccggcgacgcagcgcgtg
ctggcgcgcaccggctggaagctcgacgacctcgacctgatcgagggcaatgaagcgttc
gccgcgcaggcgctcggcgttgcccgcgaactgaagtgggactggaaccgcgtcaacgtc
aacggcggcgcgatcgcgcttggccatccgatcggtgcatcgggtgcgcgtatcctggtg
acgctgctgcacgaaatgatccgccgcgatgcgaagaagggtctggcaacgctgtgcatc
ggcggtggcatgggtgtggcgctggcggtcgaacgctga

DBGET integrated database retrieval system