KEGG   Jeongeupia sp. USM3: BJP62_11125Help
Entry
BJP62_11125       CDS       T04552                                 

Definition
(GenBank) glutamate-1-semialdehyde-2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
jeu  Jeongeupia sp. USM3
Pathway
jeu00860  Porphyrin and chlorophyll metabolism
jeu01100  Metabolic pathways
jeu01110  Biosynthesis of secondary metabolites
jeu01120  Microbial metabolism in diverse environments
Module
jeu_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
jeu_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:jeu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BJP62_11125
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:jeu01007]
    BJP62_11125
Enzymes [BR:jeu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     BJP62_11125
Amino acid related enzymes [BR:jeu01007]
 Aminotransferase (transaminase)
  Class III
   BJP62_11125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AOY00945
UniProt: A0A1D9BF28
Position
2373611..2374885
Genome map
AA seq 424 aa AA seqDB search
MTQNEQLFDAAQKHIPGGVNSPVRAFGSVGGTPRFFKKGEGAYVWDADGQRYIDYVGSWG
PLILGHAHPQVLDAVIAAARDGLSFGAPTQREIDLADLLCEMLPSIEQVRLVSSGTEATM
SAIRLARGFTGRDKLVKFEGCYHGHADSLLVKAGSGLLTFGNPSSAGVPAAVAADTIVLP
YNDVAALEALFAAEGDKIAAIIVEPVAGNMNLVKASPGFVAAMRSLTERHGAVLIYDEVM
TGFRVGLDCAQGLHGVTPDLTCLGKVVGGGMPLAAFGGRADIMARLAPLGPVYQAGTLSG
NPVAVAAGLATLQAIRAPGFFEQLSAKTAALADGLGAAARDADVAFSAQSVGGMFGVYFS
TTAPQSFADVMASDRTRFNAFFHAMLAEGIYLAPSAFEAGFVSAAHSDADIDATIAAAAR
IFKA
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgacccagaacgaacaactcttcgacgccgcgcagaagcacatccccggcggtgtcaat
tcgccggtgcgcgccttcggctcggtcggcggcacgccgcgcttcttcaagaaaggcgaa
ggcgcctacgtctgggacgccgacggtcagcgctacatcgactacgtcggctcctggggg
ccgctgatcctcggccacgcgcatccgcaggtgctcgatgcggtgatcgccgccgcacgc
gacggcctgtcgttcggcgcaccgacgcagcgcgagatcgacctcgccgacctgctgtgc
gagatgctgccgtcgatcgaacaggtccggctggtatcgagcggcaccgaggcgacgatg
agcgcgatccggctcgcacgcggcttcaccggccgcgacaagctggtcaagttcgaaggc
tgctaccacggccatgccgacagcctgctggtgaaggccggctcgggcctgctgaccttc
ggcaacccgtcgagcgccggcgtgccggccgccgtcgccgccgacaccatcgtgctgccc
tacaacgatgtcgccgcgctggaagcgctgttcgcagcagaaggcgacaagatcgccgca
atcatcgtcgaaccggtcgccggcaacatgaacctggtcaaggcatcgcccggcttcgtc
gcggcgatgcgctcgctgaccgagcgccatggcgcggtgctgatctacgacgaggtgatg
accggtttccgtgtcggcctcgactgcgcgcaggggctgcacggcgtgacgccggacctg
acctgcctgggcaaggtcgtcggcggcggcatgccgctggcggcattcggcggccgcgcc
gacatcatggccagactggcgccgctcggcccggtctatcaggccggcacgctgtcgggc
aacccggtcgccgtcgccgccggccttgccaccttgcaggcgatccgcgcaccaggcttc
ttcgagcaactttccgcgaaaaccgccgcgctggccgacggcctcggcgccgcggcccgc
gatgccgacgtcgcgttctcggcgcaaagcgtcggcggcatgttcggcgtctacttcagc
accacggcgccacagtcgtttgccgacgtgatggcatcggaccggacgcgcttcaacgcc
ttcttccatgcaatgctcgccgagggaatctacctcgcgccgtcggcgttcgaagccggc
ttcgtctccgccgcccacagcgatgccgatatcgacgcgacgatcgccgccgccgcgcgc
atcttcaaagcctga

DBGET integrated database retrieval system