KEGG   Jeongeupia sp. USM3: BJP62_16980Help
Entry
BJP62_16980       CDS       T04552                                 

Definition
(GenBank) pseudouridylate synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
jeu  Jeongeupia sp. USM3
Brite
KEGG Orthology (KO) [BR:jeu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:jeu03016]
    BJP62_16980
Enzymes [BR:jeu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     BJP62_16980
Transfer RNA biogenesis [BR:jeu03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    BJP62_16980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AOY01983
UniProt: A0A1D9BI01
Position
complement(3608064..3608807)
Genome map
AA seq 247 aa AA seqDB search
MSRETLPELYRDDALVAVHKPSGLLVHRSMIDRHETRFAMQIVRDQIGRRVYPVHRLDKG
TSGVLMFALDPDTAKLLTAAFETRAIEKDYLAVVRGWLPEAGTVDHPLTRLVDAYEFAGE
TSATDAQDAVTDYRRLATIELPIAVDRYSTSRYSLAALSPLTGRRHQLRRHLKHLSHPII
GDATYGKGRHNRMFAEHFGANRMLLACTGLRLAHPHTGATLNLTCPLAADMQGVIDALGW
ADAGIRH
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcgaaaccctgcccgagctgtaccgcgacgatgcgctggtcgcggtccacaag
ccctcgggcctcctggtgcaccggtcgatgatcgaccggcacgagacgcgtttcgcaatg
cagatcgtccgcgaccagatcggccggcgcgtctacccggtgcaccggctcgacaagggc
acgtcgggcgtgctgatgttcgcgctcgacccggacaccgccaagctgctgacggcggcg
ttcgagacgcgcgcaatcgaaaaggactacctcgccgtcgtgcgcggctggctgcccgaa
gccggcaccgtcgatcaccctctgacccggctcgtcgacgcctacgaatttgccggcgaa
accagcgcgaccgacgcgcaggacgcggtcaccgactaccgccgactggcgacgatcgag
ctgccgatcgccgtcgaccgctattcgaccagccgttactcgctggccgcgctgtcgccg
ctcaccggccggcgccaccagctgcgccggcacctgaagcacctgagccacccgatcatc
ggcgacgccacctacggcaagggtcgccacaaccggatgtttgccgaacacttcggcgcc
aaccggatgctgctcgcctgtaccggattgcgcctcgcgcatccgcacaccggcgcaacg
ctcaatctgacctgcccgctggccgccgatatgcagggcgtgatcgatgcactggggtgg
gccgacgccggtatccgacattaa

DBGET integrated database retrieval system