KEGG   Janibacter limosus: EXU32_01335Help
Entry
EXU32_01335       CDS       T05853                                 

Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
jli  Janibacter limosus
Pathway
jli00360  Phenylalanine metabolism
jli00400  Phenylalanine, tyrosine and tryptophan biosynthesis
jli00790  Folate biosynthesis
jli01100  Metabolic pathways
jli01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:jli00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    EXU32_01335
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EXU32_01335
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    EXU32_01335
Enzymes [BR:jli01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     EXU32_01335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: QBF45027
Position
275213..276133
Genome map
AA seq 306 aa AA seqDB search
MFTEGQLYSPVTTHEDGTVEVHLADTHPGRDDAQYLQRRGEIAGAALAWDRGNVPVPTIV
YTPQEHAVWSRVSHELAPLHARFAHREYLEAKERLGLPTGHVPQLAEVSERLLPLTGWSY
VCAPGLVPLRDFYADLGGRTFNSTQYLRHGAEPLYTPEPDIIHEVIGHANQLASPRLAAI
TEAAGRASLRLETDEAMKLVADVFWFSIEFGVMYDGDDLKAYGAGILSSYGEIQEFADME
IRDLDLADMGTLNYDITAYQPVLFAARSMTHLEDVVGDFFATVDDDAAAALRVEAGRRGL
LPLARH
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtgttcaccgagggacagttgtactcacccgtgaccacccacgaggacggcaccgtcgag
gtgcacctcgccgacacgcacccgggccgtgacgatgcgcagtacctgcagcgccgtggt
gagatcgccggcgcagctctcgcatgggaccggggcaacgtgcctgtgcccaccatcgtg
tacacgccgcaggagcacgccgtctggagccgggtcagccacgagctcgcgccgctgcac
gccaggttcgcccaccgtgagtacctggaggccaaggagcggctcgggcttccgacaggg
cacgtcccccagctcgccgaggtgagcgagcgactcctgccgctcaccggctggagctac
gtgtgcgcaccggggctggtcccccttcgcgacttctacgccgacctcggcggccgcacc
ttcaactccacccagtacctgcgccacggggctgagcccctttacacacccgagccggac
atcatccacgaggtcatcgggcacgccaaccagctggcgagcccgcgcctcgcggcgatc
accgaggccgcggggcgggcgtcgctccggctcgagaccgacgaggcgatgaagctggtc
gctgacgtcttctggttctccatcgagttcggcgtcatgtacgacggcgacgacctcaag
gcctacggcgcggggatcctgtcgagctacggcgagatccaggagttcgccgacatggag
atccgcgacctcgacctggccgacatgggcacgctcaactacgacatcaccgcctaccag
ccggtgctcttcgccgcccggtcgatgacccacctcgaggacgtcgtcggagacttcttc
gcaaccgtcgacgacgacgccgcagctgccctgcgggtggaggcgggacgtcgggggctg
ctgcctctggcccggcactga

DBGET integrated database retrieval system