KEGG   Janibacter limosus: EXU32_02260Help
Entry
EXU32_02260       CDS       T05853                                 

Gene name
mca
Definition
(GenBank) mycothiol conjugate amidase Mca
  KO
K18455  mycothiol S-conjugate amidase [EC:3.5.1.115]
Organism
jli  Janibacter limosus
Brite
KEGG Orthology (KO) [BR:jli00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EXU32_02260 (mca)
Enzymes [BR:jli01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.115  mycothiol S-conjugate amidase
     EXU32_02260 (mca)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIG-L
Motif
Other DBs
NCBI-ProteinID: QBF47837
UniProt: A0A4P6MZL5
Position
459157..460092
Genome map
AA seq 311 aa AA seqDB search
MAVHAHPDDESSKGAATSARYVDEGAEVLVVTCTGGERGDVLNPGLKDDPHILRDIVEVR
REEMAKAAAFLGVQHTWLGFVDSGLPEGDPLPPLPAGCFYLEPLEVATEALVREIRRFRP
HVVTTYDENGGYPHPDHVMTNRISEAAFEAAGDPEAYPHAGEPWQPLKLYYIGGFSIDRI
RTFHEALVAHGADSPFESWMERAGSRPQRHLTTWVPCSDHFEARDNALRAHATQIDPAGF
FFALPNDVQADLWPTEEYELAVSHVPTQEREDDLFAGIPSRLAEADALAQRLGGAEPILD
RRAEPTVKEWT
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggccgtccatgcgcaccccgacgacgagtcgagcaagggcgcggcgacgtctgcccgc
tacgtcgacgagggcgcggaggtcctcgtcgtgacctgcaccggcggtgagcgcggggac
gtgctcaaccccggcctcaaggacgacccacacatcctgcgcgacatcgtggaggtgcgc
cgcgaggagatggccaaggcggccgccttcctcggggtgcagcacacgtggctgggcttc
gtcgactccggcctccccgagggggacccgctgccgcccctgccggccgggtgcttctac
ctcgagcccctcgaggtggccaccgaggccctcgtgcgcgagatccgccgcttccgtccg
cacgtcgtcacgacctatgacgagaacggcggctatccgcacccggaccacgtgatgacc
aaccggatctccgaggcggccttcgaggcggccggcgaccccgaggcctacccccacgcg
ggcgagccgtggcaaccgctcaagctctactacatcggtgggttcagcatcgaccggatc
cgcaccttccacgaggcgctcgtcgcccatggtgcggactctcccttcgagtcgtggatg
gagcgcgcgggcagccgaccgcagcgtcacctcaccacgtgggtgccgtgctcggaccac
ttcgaggcgcgcgacaacgccctgcgcgcgcacgccacccagatcgaccctgccggtttc
ttcttcgccctgcccaacgacgtccaggccgacctctggccgaccgaggagtacgagctc
gccgtcagccatgtgccgacccaggagcgcgaggacgacctcttcgcggggatcccgtca
cgcctcgccgaggccgacgccctggcccagcgtctgggtggggccgagccgatcctggac
cgccgggccgagccgaccgtcaaggagtggacgtga

DBGET integrated database retrieval system