KEGG   Janibacter limosus: EXU32_10085Help
Entry
EXU32_10085       CDS       T05853                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
jli  Janibacter limosus
Pathway
jli00250  Alanine, aspartate and glutamate metabolism
jli00330  Arginine and proline metabolism
jli01100  Metabolic pathways
jli01110  Biosynthesis of secondary metabolites
jli01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:jli00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EXU32_10085
   00330 Arginine and proline metabolism
    EXU32_10085
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:jli03000]
    EXU32_10085
Enzymes [BR:jli01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     EXU32_10085
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     EXU32_10085
Transcription factors [BR:jli03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    EXU32_10085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh
Motif
Other DBs
NCBI-ProteinID: QBF46572
Position
2108405..2111827
Genome map
AA seq 1140 aa AA seqDB search
MTTTSAPTDPSTAAFAPFVEDAIALAERWSAAAHAGETRREAQTTGQLAALLSDHAGLDL
AVFFVDRVARPEDNTVAATALNRITASDSASFLGTLDRSLLGLGARAAKIAPQVVVPAAR
ARMKQMVGHLIVDARDPKLGKHLAAAREDGFRLNINLLGEAVLGESEAAARTERTREILE
RADVDYASIKVSSLVSQISTWDTDGTVERCLTRLRPLYETAKASTPHAFVNLDMEEYRDL
EMTMEVFMTLLSEPQFHDLEAGIVLQGYLPDALPAMERLVDFAIGRRDAGGAPIKIRLVK
GANLAMERVEAAMHGWEQAPYPTKADVDANYLRCIERALRPELAGALRLGVASHNLYDVA
AAHLLAQHRGVQDSLDVEMLQGMSPAQARAVRDEVGTVILYTPVVAPKDFDAAVSYLVRR
LEETASPENYIHASFADDPAAMPDQERRFRASIEDIGSVPVGPRRSAERAPIGDDFDNTP
DSDPALPATREWAARAVTAARPEPTSPHLAITEAVDDVVDVARTAQQSWAARPATERADL
LRKAAREIDSRREELLAVMAAEAGKTIAEADPEISEAVDFARYYADRALELEDGPMTDGA
RFTPFALTLVAPPWNFPVAIPIGGVLAALAAGSAVIIKPAPQTPVCVEVTVAALHAAGIP
EDVLQVVRTDEDEVGQHLVAHPGVDAVVLTGASETARLFAGWRAGLSEGARVLGETSGKN
SLIITPSADIDLAVADLVSSAFGHAGQKCSAASLGILVGSIADSPRFRRQLVDAVESIAV
GWPSDLGTRMGPVIEAPSGKLLRALTTLEPGETWLVEPKQLDDTGRLWSPGVKDGVRPGS
FFHLTEVFGPVLGLMRADSLDEAIELQNATDFGLTGGLHSLDEGEILRWTDAAAVGNAYV
NRHITGAIVRRQSFGGWKASSIGPGAKAGGPNYIAQLGTWTSDGLPTKGASVTSAVRATV
DAQLAALGDRVADDERGWLEAAIASDAAAWASELGVEHDESNLVVETNVFRYRAHPRVLV
RAGEGARLVEVLRLVAAATLTGAHVTVSAVPSLSLPSSIGHVQVVTESDSAFLARAGHAS
DVRVRAVGGAPASLVDDLVAAGVDVITGEVLATGRRELLPFVREQAVSTTRHRFGHVAGA
NT seq 3423 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccacctctgcgccgaccgacccgagcaccgcagccttcgcccccttcgtcgag
gacgcgatcgccctcgccgagcggtggtccgctgccgcccacgccggggagaccaggcgc
gaggcgcagacgaccggtcagttggccgccctgctgtccgaccacgccgggctcgacctc
gcggtcttcttcgtcgaccgcgtcgcccgccccgaggacaacacggtcgccgcgactgcg
ctgaacaggatcaccgcgtcggactccgcgtccttcctcggcaccctcgaccgcagcctc
ctcggcctcggtgcccgtgcggcgaagatcgccccccaggtcgtcgtgcccgccgcccgc
gcccggatgaagcagatggtcggccacctcatcgtcgacgcccgtgacccgaagctcggc
aagcacctggctgccgcccgcgaggacgggttccgactcaacatcaacctcctcggcgag
gccgtgctcggcgagagcgaggcggccgcgcgcaccgagcgcacccgcgagatcctcgag
cgcgccgacgtcgactacgcctcgatcaaggtctcctcgctcgtcagccagatcagtacc
tgggacaccgacggcaccgtcgagcgctgcctgacccggctgcggccgctctacgagacc
gccaaggcgtccacgccgcacgccttcgtcaacctcgacatggaggagtaccgcgacctc
gagatgacgatggaggtcttcatgaccctgttgtccgagccgcagttccacgacctcgag
gccggcatcgtcctgcagggctacctgcccgacgccctgcccgcgatggagcggctcgtc
gacttcgcgatcgggcgccgcgacgccggcggcgctccgatcaagatccgcctcgtcaag
ggcgccaacctcgcgatggagcgcgtcgaggcggccatgcacggctgggagcaggcgccc
tacccgaccaaggccgacgtcgacgccaactacctgcgctgcatcgagcgcgcgctgcgc
cccgagctcgccggggccctgcgcctgggcgtcgcctcgcacaacctctacgacgtcgcc
gccgcgcacctgctcgcgcagcaccgtggtgtccaggactccctcgacgtcgagatgctc
cagggcatgtcgcccgcgcaggcccgggccgtgcgcgacgaggtcggcacggtgatcctc
tacacgccggtcgtcgcgcccaaggacttcgacgcagccgtctcctacctcgtgcgccgc
ctcgaggagaccgcctcgccggagaactacatccacgcctccttcgccgacgacccggcc
gccatgcccgaccaggagcgccgcttccgcgccagcatcgaggacatcgggtccgtcccc
gtcggcccgcgccgctccgccgagcgcgccccgatcggtgacgacttcgacaacaccccc
gactccgacccggccctgcccgccacccgtgagtgggccgcccgcgccgtcaccgccgcg
cgccccgaaccgacctcaccccacctggccatcaccgaggcggtcgacgacgtcgtcgac
gtcgcgcgcaccgcgcagcagagttgggcggcgcggcccgccacggagcgagcagacctg
ctgcgcaaggccgctcgtgagatcgacagccgtcgtgaggagctgctggcggtcatggca
gcggaggccggcaagaccatcgccgaggccgacccagagatctcggaggccgtcgacttc
gcccgctactacgccgaccgggccctcgagctcgaggacgggccgatgaccgacggggcg
aggttcacccccttcgccctgacgctggtggccccgccgtggaacttccccgtcgctatc
cccatcggtggcgtgctcgcggccctcgccgcgggctcggccgtcatcatcaagccggcc
ccgcagacccccgtgtgcgtcgaggtcaccgtggcggcgctgcacgccgcgggcatcccc
gaggacgtgctgcaggtcgtgcgcaccgacgaggacgaggtcggtcagcacctcgtcgcc
caccccggtgtcgacgccgtcgtactcaccggtgccagcgagaccgcgcggctcttcgcc
gggtggcgggccggcctttccgagggtgcccgcgtcctcggcgagacctcgggcaagaac
tccctgatcatcaccccgtccgccgacatcgacctggccgtcgccgacctcgtctcctcc
gccttcggccacgccgggcagaagtgctcggccgcctcgctcggcatcctcgtcggctcg
atcgccgactccccgcggttccgccgccagctcgtcgacgccgtcgagtccatcgccgtc
ggctggccgagcgacctcggcacccggatgggtccggtcatcgaggcgccgagcggcaag
ctgctccgggcgctcaccacgctcgagcccggcgagacctggctggtcgagcccaagcag
ctcgacgacaccggccggctgtggtcgccgggcgtcaaggacggggtgcgtcccgggtcc
ttcttccacctcaccgaggtcttcggtcccgtgctcggactcatgcgcgccgactccctc
gacgaggccatcgagctgcagaacgcgaccgatttcggcctcacgggcgggctgcacagc
ctcgacgagggcgagatcctgcgctggacggacgcggccgcggtcggcaatgcctacgtc
aaccggcacatcaccggtgccatcgtgcgccgccagtccttcggcgggtggaaggccagc
tccatcggccccggcgccaaggcgggcggccccaactacatcgcccagctcggcacgtgg
acgagcgacggactgccgacgaagggagcgtccgtcacctccgcggtccgcgcgaccgtc
gacgcgcagctggcagcgctcggtgatcgcgtggccgacgacgagcggggctggctcgag
gcggcgatcgccagtgacgccgccgcctgggcgagcgagctcggtgtcgagcacgacgag
agcaacctcgtcgtcgagaccaatgtcttccgctaccgcgcccacccacgggtgctcgtg
cgggccggtgagggcgcccggctggtcgaggtcctacggctcgtcgccgcagcgaccctg
accggggcccatgtcactgtgtcggcggtcccgtcgctcagcctgccgagcagcatcggg
cacgtgcaggtcgtcaccgagagcgacagcgccttcctcgcccgggcggggcacgcgagc
gacgtgcgggtccgtgccgtcggcggcgctccggcatcgctcgtcgacgacctcgtcgcc
gctggtgtcgacgtcatcaccggtgaggtcctggccacgggacgacgcgagctcctcccc
ttcgtcagggagcaggcggtcagcacgacccggcaccgcttcggccacgtggccggcgcc
tga

DBGET integrated database retrieval system