KEGG   Janibacter limosus: EXU32_13925Help
Entry
EXU32_13925       CDS       T05853                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
jli  Janibacter limosus
Brite
KEGG Orthology (KO) [BR:jli00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    EXU32_13925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 EMP70
Motif
Other DBs
NCBI-ProteinID: QBF48044
UniProt: A0A4P6MW64
Position
complement(2906075..2907037)
Genome map
AA seq 320 aa AA seqDB search
MGFNYTNGFHDAANAIATSVSTRALTPRAALAMAAVANLFGAFFGAKVAETVGKGIIDAP
DGNLGLVLCGAALLGAIGWNLLTWWLGLPSSSSHALIGGLGGAALVAGAAVKWMGIFEKV
IVPMLISPVVGIIVGFLVMKLILRLFHDANPGRTKRGFRMAQTGSAAAMAFGHGMQDAAK
TAGVVVLALTVSGHHPSGDDSIPLWVLVMSAVVISMGTYAGGWRIMRTLGRGIIHLDPPQ
GFAAEVTAASILYVATMLKAPISTTHAITAAIMGVGSTKSLKAVRWGVAKNIVGAWILTF
PGAGLSAAICMWIGMAVFGV
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgggcttcaactacaccaacggcttccatgacgcggccaacgcgatcgcgacctcggtc
tcgacccgggcactgaccccccgcgccgcgctcgccatggccgcggtggccaacctcttc
ggtgccttcttcggtgccaaggttgccgagaccgtgggcaagggcatcatcgacgccccg
gatggcaacttgggcctcgtgctctgcggtgcggcactgctcggcgccatcggctggaac
ctcctcacctggtggttgggcctcccttcgtcctcgtcgcacgccctcatcggcggtctc
ggcggggcagcgctcgtcgccggggcggcggtgaagtggatgggcatcttcgagaaggtc
atcgtcccgatgctcatctcgcccgtggtcggcatcatcgtcggcttcctggtgatgaag
ctgatcctgcggttgttccacgacgccaaccccggccgcaccaagcgcggcttccggatg
gcgcagaccggctccgcggccgccatggccttcggtcacggcatgcaggacgccgccaag
accgctggtgtcgtcgtcctggccctcaccgtctccggccaccaccccagcggcgacgac
agcatcccgttgtgggtcctcgtgatgtccgcggtcgtgatctccatgggtacctacgcc
ggtggctggcggatcatgcgcacgctgggtcgcggcatcatccacctcgacccgccgcag
ggcttcgccgccgaggtcaccgcggcgtcgatcctctacgtcgcgacgatgctcaaggca
ccgatctccacgacgcacgcgatcaccgcggcgatcatgggcgtcggctcgacgaagtcg
ctcaaggccgtccggtggggcgtcgccaagaacatcgtcggcgcctggatcctcaccttc
cccggcgcgggcctgtccgcggcgatctgcatgtggatcggcatggcggtcttcggcgtc
tga

DBGET integrated database retrieval system