KEGG   Juglans regia (English walnut): 108980041Help
Entry
108980041         CDS       T05245                                 

Definition
(RefSeq) wall-associated receptor kinase 2-like
Organism
jre  Juglans regia (English walnut)
Brite
Enzymes [BR:jre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108980041
Protein kinases [BR:jre01001]
 Serine/threonine kinases: TKL group
  IRAK family
   108980041
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr GUB_WAK_bind EGF_CA WAK Haspin_kinase EGF_3 cEGF PIP49_C FXa_inhibition EGF hEGF APH Mad3_BUB1_I_2
Motif
Other DBs
NCBI-GeneID: 108980041
NCBI-ProteinID: XP_018806402
UniProt: A0A2I4DGY2
Position
Unknown
AA seq 773 aa AA seqDB search
MQAMSSSLQTVLLQQQQEAAVKFLLGVFVISAAMFVPTVAVKIPNFNCNRTCGSLEIPYP
FGTSEDCYLDSSFLITCNSSSKFKMSTPTPYLHHSDIKVLNISLDGELRVSSSVTRDCPQ
KSDYNADDSYDVLLLKEFPISYTKNVLTAVGCDTLALITSSESSDKKYMTGCVALCESMD
GMVNESCSGVGCCQTSIPVGIKDFIVHVSSVNNHSNVSKFSPCGFAFVVEKKEYNFSTLD
LRNMQNKKVVPLVLDWAVGKQTCEYAKENITGYACKEANSECYNSTNGHGYRCKCSKGYY
GNPYLSSGCNDIDECKTPNHECADNACVNLVGSYSCSCPIGYQGDGWRNGSSCTPVIPKP
SNSKNIIIALCISISLLVLLLGGSSIFLGLKRRKFMKLQEKYFQQNGGLMLQEHILNHGR
SMETTKIFSNDELKKATNNYDESRVLGKGGYGTVYKGVLADNKEVAIKKSKVCDKSQIEQ
FINEVILLTQINHRNVVKLLGCCLETEVPLLVYEFITNGTLSDHIHDLSRASSFSWEKRL
KIATEIARALAYLHFETSMPIIHRDVKSTNILLDDNHTAKVADFGASRLIALDQTEITTL
VQGTRGYLDPEYFQTGKLSEKSDVYSFGVVLAELLTGEKAISSYRPESYKNLAMFFVSAI
KEDRLLHILEDHIVNEGNIEALKEVANLAEGCLRLRGEDRPTMMEVAMKLEGLRIMEKHP
WGKDNQTTEETEYVLCTPVVPFNIDIGVGSSVSAVSGPDNMINQVLKPPDDGR
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atgcaagctatgtcctcctcgcttcaaactgttcttctgcagcagcagcaagaagctgct
gtaaaattcctgcttggggtatttgtaatttcagcagcaatgtttgtaccaacagtagca
gttaaaatacccaatttcaattgcaacagaacctgtggatcgcttgaaatcccctaccca
tttggaacatccgaagactgctatcttgactcatcttttctcattacttgtaactcctcc
tccaaattcaagatgagtactccaacaccatatctacaccatagtgacataaaggtactc
aatatatcattagatggtgaactacgagtctcatcttctgtaacccgtgattgcccacag
aaatcagactataatgccgacgacagctacgatgttctcctcctgaaagagtttcccatc
tcatatacaaagaacgtgctcaccgcagtcggttgcgacactttggcgctcattacaagt
tcagagtcttcagacaagaagtatatgactggatgcgtggcactctgtgaaagcatggat
ggtatggttaacgagtcttgctctggcgtaggttgttgccagacttctatcccagttgga
ataaaagattttattgtgcacgttagcagcgttaacaaccactccaacgttagcaaattc
agtccatgtggttttgcctttgtggtggaaaaaaaagaatacaacttttcaaccttagat
cttcggaatatgcagaataaaaaagttgttccgttggtgctagattgggcagtagggaag
cagacatgcgaatatgctaaggagaatattacaggatacgcgtgtaaggaagcaaatagt
gaatgctacaattccacaaacggtcatgggtatcgctgtaaatgctccaaaggctattac
ggaaacccatatctctctagtggttgcaacgatattgatgagtgtaaaactccaaatcat
gagtgcgctgataatgcatgcgtcaacctcgtggggtcttacagctgttcttgccccatt
gggtaccaaggagatgggtggagaaatggaagtagttgcactcccgttattcctaaacca
agcaattctaagaatatcatcattgcactttgtatcagcataagtctcttagtcttgctc
ttgggaggttcttcaatatttttgggattgaaaagaaggaagttcatgaaactccaagaa
aagtacttccaacaaaatggtggcttaatgttacaagaacatattttgaatcatggaaga
tccatggagacaacgaaaatctttagtaatgatgagcttaaaaaagccaccaacaattat
gatgagagtagagtccttggcaaagggggttatggaactgtttacaaaggagtattagcc
gataacaaagaggttgccataaaaaagtccaaagtctgtgataagagccaaattgaacaa
tttataaatgaggtaattttgcttacccaaatcaatcatagaaatgtggtcaaactatta
ggttgttgtcttgaaacagaagttcccttacttgtatatgaattcatcacaaatgggact
ctttctgaccatattcatgatcttagtcgggcttcttcattttcatgggaaaaacgtttg
aagatagcaacagaaatagcaagagcacttgcatacctacattttgaaacttctatgcca
attatacatagagatgtgaaaagcacaaatatattgttagatgataaccacactgcaaaa
gtggctgactttggagcttcaaggttgatagctcttgatcaaacagaaataactaccttg
gtgcaaggaactcgtgggtacttagaccctgaatacttccaaactggcaagttatcagaa
aaaagtgatgtgtacagtttcggtgttgtgttggcagagttgttgacaggtgaaaaggca
atttcttcctataggcctgaaagttacaaaaaccttgcaatgttttttgtttctgcaatt
aaagaagatcgcctgcttcacattcttgaggatcacattgtcaatgaaggtaatattgag
gcattaaaggaagttgctaatcttgcagaagggtgcttaaggttaaggggggaggatagg
cccactatgatggaagtggcaatgaagcttgaaggattgagaatcatggaaaagcatcca
tggggaaaggataatcaaaccacagaagaaacagaatatgtgctatgtacacctgtagtc
cctttcaacattgacattggagttggttcttctgtaagtgcagttagtggacctgataac
atgataaaccaagtcttgaaacccccagatgatggtcgataa

DBGET integrated database retrieval system