KEGG   Juglans regia (English walnut): 108980088Help
Entry
108980088         CDS       T05245                                 

Definition
(RefSeq) wall-associated receptor kinase 2-like
Organism
jre  Juglans regia (English walnut)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr GUB_WAK_bind EGF_CA cEGF EGF APH EGF_3 PIP49_C
Motif
Other DBs
NCBI-GeneID: 108980088
NCBI-ProteinID: XP_018806449
UniProt: A0A2I4DH24
Position
Unknown
AA seq 753 aa AA seqDB search
MCFSKMMFLQVINMTWVAVVGVILILEMAASATILAAVAAPLAKLNCNDRCGDVKIPFPF
GTSEGCYLDHNYFVNCTYDSSSKTLRPMYGDFVVQNISFEGKFELIFKYPVYECFNELGP
LANPRSRFPINFSSSFSYTHNVFVAIGCDTIAYLNGTKNNGNFSTGCLSVCENTNDVVNG
SCSGIGCCQGEIPKGFMESSLAVQSFSKHKGVWKSNPCSYAFIVKRDAFHFSTEDLIPNV
SNMTFPVVFDWGIRYEKCDFASAKSDFLCGKNSACNDSWYGYHCRCKPGYDGNPYLPYGC
QDINECNSSTDNNCTYQNLCKNTNGSYKCSCPKGKRGDGRKNGTGCSVNRRLRNTRIGVG
TGTTLLVVLVGSVWVYWVLKTRKIFELKLKFFNLNGGPMLRQQLSNHQGPMEPLKIFSAE
ELEKATNNYDKSRILNQGGNRTVYRGVLTDNKVVAIKKSKIVDENQIEHFIKEMIVLNQI
NHRNVVKLLGCCLETKVPLLVYEFITDWTLYDHIHDKDKSSLFSWEKRLKIATEAAGALA
YLHFETSKPIIHGDVKSANILLDENHTTKVADFGASRLVPLDHTRLEQGTFGYLDPEYLR
SGQLTEKSDVYSFGVVLAELLTGEKVISLDRAEKDKNLATYFVSALEDDRLEEIIECHIK
NEGDVEEQNEVSYIAKRCLSINGKKRPTMKDVAMELERLRSKKNHSNEMADLLREETKSY
LNPDVGTANSSTNTTIDSIMQFLPTCCSMIPLF
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atgtgtttctcaaagatgatgttcttgcaagtgatcaacatgacatgggtcgctgtcgtt
ggtgtcatattaatattagaaatggcagcttctgcaacaattctagcagcagtagcagct
ccattagcaaagcttaactgcaacgaccggtgtggagatgttaaaattccatttccattt
ggcacttctgaagggtgttatctcgatcataattacttcgtcaactgcacatacgattcc
tccagcaaaaccctccggccaatgtatggagatttcgttgttcagaacatttccttcgaa
ggtaaatttgagttaatctttaagtaccctgtttatgaatgtttcaatgagttgggaccc
cttgcaaatccacgtagtcgtttccctataaatttctccagttcattttcttacacccac
aacgtgttcgtggccattggttgtgacactattgcttaccttaatggtaccaagaacaat
ggaaacttctccacgggatgcctctctgtttgtgaaaacaccaacgatgtggtcaatggg
tcttgttctggaattgggtgttgccaaggagagattccaaaaggatttatggaatctagt
ttagcggtacagagcttttctaagcacaaaggagtatggaagtccaatccttgcagctat
gctttcattgttaaaagagatgcattccatttctccaccgaagatctgattccaaacgtg
tccaatatgacatttccggtggtctttgattgggggattagatatgaaaagtgtgatttt
gctagcgcaaagtcggacttcctatgcggaaagaacagtgcatgtaatgattcctggtat
ggataccattgcagatgcaaacccggttatgatggaaacccatacctcccttatggttgc
caagatattaacgagtgcaattcaagtactgataataattgcacatatcaaaatctctgt
aaaaacacaaacgggagttataaatgttcttgccccaaagggaaacgaggggacggaaga
aagaatggaaccggttgttctgtgaatcgccgactgcggaacactaggattggtgttggt
accggcacaaccctcttagtggttctagttggaagcgtttgggtatattgggtactaaaa
acaagaaaaatctttgagctcaaactgaaattcttcaacctaaatggtggcccaatgttg
cgacaacaactctctaatcaccaaggaccaatggaaccacttaaaatcttcagtgcagaa
gaacttgagaaggccactaataattatgacaagagtagaatccttaaccaaggaggcaat
cgaacggtttatcgaggagtattaacagataataaagttgttgctattaagaagtccaaa
attgttgatgaaaaccagattgaacacttcataaaagaaatgattgtgcttaatcaaata
aaccacaggaatgtggttaaactattgggttgttgtttggaaacaaaagtgcccttgtta
gtttatgaattcatcacagattggacactttatgaccacatccatgataaagacaaatca
tccttattctcatgggaaaagcgtttgaaaatagcaacagaagctgcaggagcccttgca
tacctacattttgaaacttccaaaccaatcatacacggagatgtgaaatctgcaaatata
cttttagacgagaatcatacaacaaaagttgctgactttggagcttcaagactagttcct
cttgatcacacacgattagagcaaggaacatttgggtacttggaccctgaatacttacgc
agtggccaattaacagaaaaaagtgatgtctatagctttggcgttgttttggcagagtta
ctgacaggtgagaaggtaatttctttggatagggcagaaaaagataaaaatctagcaaca
tactttgtttctgctctagaagatgatcgcctagaagaaattattgagtgccacattaaa
aatgagggtgatgttgaagagcaaaacgaagtttcgtatattgcaaaaaggtgcttaagc
ataaatggaaagaaaagacctactatgaaggatgtggcaatggagctagagagattgaga
agtaagaaaaatcattcaaatgagatggccgatctcttgagagaagaaaccaagagctat
ttgaatcctgatgttggcactgccaattcttcaaccaataccaccattgatagcattatg
caatttctacccacctgttgctccatgattcctctgttctga

DBGET integrated database retrieval system