KEGG   Juglans regia (English walnut): 108980472Help
Entry
108980472         CDS       T05245                                 

Definition
(RefSeq) autophagy-related protein 16
  KO
K17890  autophagy-related protein 16-1
Organism
jre  Juglans regia (English walnut)
Pathway
jre04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:jre00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    108980472
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:jre04131]
    108980472
   03029 Mitochondrial biogenesis [BR:jre03029]
    108980472
Membrane trafficking [BR:jre04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    108980472
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    108980472
Mitochondrial biogenesis [BR:jre03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    108980472
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ATG16 ANAPC4_WD40 Nup160 Cytochrom_D1 Glutaredoxin2_C DUF2935
Motif
Other DBs
NCBI-GeneID: 108980472
NCBI-ProteinID: XP_018806956
UniProt: A0A2I4DII5
Position
Unknown
AA seq 509 aa AA seqDB search
MSQDQIAREAIKHALRSLRKRHLLEEGAHSPAFIALTRPIASQGSEWKEKAENLELELQQ
CYKAQSRLSEQLVVEVAESRASKASLQEKESAVSNLQAELTQTRDECSQLKADLEEKIKA
LELLICENHQLKAQLEEITIKAKNAEAENKMLVDRWMLQKMQDAERLNEANALYDEMVNR
LKASGLENLARQQVDGVVRRNEDGAEFFVESTVPSLCKQRIHAHEGGCASILFEYNSAKL
ISGGQDRSIKMWDASTGTLSHTLYGCLGSVLDLTITHDNRSVIAASSSNNLFVWDVNSGR
VRHTLTGHTDKVCAVDVSKISSRHVVSAAYDRTIKVWDLNKGYCINTIIFPSNCNALCFS
MDGHTICSGHVDGNLRLWDIHSGKLLSEVAAHSLAVTSISLSRNGNVVLTSGRDNLHNLF
DMRSLEVCGTLRAMGNRVASNWSRSCISPDDNYVAAGSADGAVYIWSISKADIVSTLREH
TSPVLCCSWSGIGKPLASADKNGIICTWS
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaggaccagatagcgagggaggcgataaagcacgctttgaggtctctacggaag
cggcatttgctcgaagaaggtgctcattctccggctttcatcgctcttaccagaccaatc
gcctctcagggctcagaatggaaagagaaagcagaaaatctggagttggaactccagcaa
tgttacaaagctcaatctcggttgtccgagcaacttgtggtcgaagtagctgaatcccga
gcttcaaaagcctcacttcaagagaaagaatcagcagtctcaaatctccaggcagagttg
actcaaacaagggatgaatgttctcaattgaaggcagacttggaagaaaagataaaagct
ttagaattgcttatatgtgagaaccatcaactcaaagctcaactggaagagataactatt
aaagctaagaatgccgaggctgaaaataagatgttagttgatcgctggatgctgcagaag
atgcaggatgctgaacggctcaatgaggcaaatgcactttatgacgaaatggttaatcgg
ctcaaggctagtggtttagaaaatcttgctaggcagcaggttgatggtgtggttcgccga
aatgaagatggtgccgaattctttgtggagtcaactgttccctccctatgcaagcagagg
atacatgcccatgaaggtggttgtgcctccatattgttcgagtacaattctgccaaactg
attagtggaggacaggaccgatcaatcaagatgtgggacgcgagcactggaacattaagt
catactctttatggttgccttggctctgttctcgatcttaccattacccatgataataga
tctgtcattgcagcaagcagctcaaacaacttatttgtatgggatgtcaattcaggccgt
gtacgccatactcttactggtcacacagataaagtttgtgctgtagatgtaagcaaaatc
tcaagtcgtcatgttgtcagtgctgcttacgatcgtaccataaaagtttgggacttgaat
aagggttactgcatcaacacaatcattttccccagcaactgtaatgctctttgcttcagc
atggacggacataccatttgttctggtcatgttgatgggaatcttcggttatgggacatt
cactcaggaaagctacttagtgaagttgccgcacattcacttgctgttacatctatctct
ttgtctcgaaatggaaatgtagtattgactagtggaagggacaacttgcataatttgttt
gatatgcgatctctagaagtttgtggcacacttagagcaatgggaaacagagtggcatcg
aattggagccgatcctgtatcagtccagatgacaactatgtagctgctggatccgccgat
ggagctgtttacatttggtccatttctaaagccgatattgtcagcactctgagggaacac
acttctcctgtgctgtgttgctcgtggagtgggatcgggaaacctctagcctcagcagac
aagaatggaattatttgtacctggtcatga

DBGET integrated database retrieval system