KEGG   Juglans regia (English walnut): 108981403Help
Entry
108981403         CDS       T05245                                 

Definition
(RefSeq) heat shock 70 kDa protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
jre  Juglans regia (English walnut)
Pathway
jre03040  Spliceosome
jre04141  Protein processing in endoplasmic reticulum
jre04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:jre00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    108981403
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    108981403
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108981403
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:jre01009]
    108981403
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:jre03041]
    108981403
   03009 Ribosome biogenesis [BR:jre03009]
    108981403
   03110 Chaperones and folding catalysts [BR:jre03110]
    108981403
   04131 Membrane trafficking [BR:jre04131]
    108981403
   03051 Proteasome [BR:jre03051]
    108981403
   03029 Mitochondrial biogenesis [BR:jre03029]
    108981403
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:jre04147]
    108981403
Protein phosphatases and associated proteins [BR:jre01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     108981403
Spliceosome [BR:jre03041]
 Complex B
  Other components
   Prp19 complex
    108981403
 Complex C
   Prp19-CDC5 complex
    108981403
Ribosome biogenesis [BR:jre03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    108981403
Chaperones and folding catalysts [BR:jre03110]
 Heat shock proteins
  HSP70 / DNAK
   108981403
Membrane trafficking [BR:jre04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    108981403
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    108981403
Proteasome [BR:jre03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    108981403
Mitochondrial biogenesis [BR:jre03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    108981403
Exosome [BR:jre04147]
 Exosomal proteins
  Proteins found in most exosomes
   108981403
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Radial_spoke_3 Hydantoinase_A Zincin_2
Motif
Other DBs
NCBI-GeneID: 108981403
NCBI-ProteinID: XP_018808096
UniProt: A0A2I4DLR7
Position
Unknown
AA seq 647 aa AA seqDB search
MASKNVGKAIGIDLGTTYSCVAVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
QVAMNPQNTVFDAKRLIGRRFSDPTVQSDMKHWPFKVVAGPGDKPMIVVQHKGEEKQFAP
EEISSMVLIKMREIAEAYLGHAVNNAVITVPAYFNDSQRQATKDAGAIAGLNVIRIINEP
TAAAIAYGLDKKGSRSGEKNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFD
NRLVNHFAAEFKRKHKKDISGNARALRRLRTACERAKRTLSSTTQTTIEIDSLYEGIDFY
ATITRARFEELNMDLFRKCMEPVEKCFRDAKIDKSQVNEIVLVGGSTRIPKVQQLLQDFF
NGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGIETAGGVMTVLI
PRNTTIPTKKEQIFSTYSDNQPGVLIQVYEGERAKTKDNNLLGKFELTGIPPAPRGVPQI
NVCFDIDANGILNVSAEDKTAGVKNKITITNDKGRLSKEEIERLVQEAEKYKAEDEEVKK
KVEARNSLENYAYNMRNTVKDEKFAGKLHPGDKQKIEKAIDETIEWLDGNQLAEADEFED
KLKELEGLCNPIVAKMYQGAGGDGPMGGGAEPSSGSSGAGPKIEEVD
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atggcatccaagaatgtaggaaaggccattggcattgaccttggcacgacgtatagctgt
gtcgccgtttggcaaaatgaccgcgtggagatcatagcaaatgaccaaggcaatagaaca
actccctcctacgttgcttttacagataccgagcggctcattggggatgcggccaagaac
caggtcgccatgaacccgcagaacacggtcttcgatgccaagcgcctcattggtcgacgg
ttttccgaccctaccgtccagagcgacatgaagcactggcctttcaaggttgtcgcagga
cccggagacaagccgatgatagtggtgcagcataaaggcgaagagaagcaattcgcgccc
gaagaaatttcttctatggtgttgatcaagatgagggagattgccgaggcttatctgggt
cacgcagtgaataacgccgtgatcacggtccctgcctacttcaacgattcgcagaggcag
gccaccaaggacgctggagctattgcgggactcaatgtgataaggattatcaatgagcca
actgccgcggccattgcttatggacttgacaagaaggggtcgaggtccggggaaaagaat
gtgcttattttcgatctcggtggtgggacattcgatgtttcactcctgtcaatcgaggaa
gggatatttgaggttaaggccactgctggtgatacccatcttggtggtgaggacttcgat
aacaggctagtgaatcactttgcggcagagttcaagaggaagcacaagaaagatattagt
ggcaatgcgagagctttgaggcggttgaggactgcatgtgagagggcgaagaggactctt
tcttcgaccactcagacgactattgagattgattcgctctatgaaggcattgatttctat
gctacaattacaagggcgagatttgaagaactaaacatggatctattcaggaagtgtatg
gaaccagtggagaaatgttttcgagacgcgaagattgacaagagtcaggttaacgagatt
gttctcgttggtgggtccacgaggattcccaaagtccagcagcttctgcaggatttcttt
aatggcaaggaactctgcaagagcataaacccggatgaggctgtcgcttatggggctgct
gtgcaagccgcaattttgagcggggaagggaatgagaaggtccaagacttactcttgctt
gatgtcacccctctcagccttggtatcgagactgctggtggcgttatgacggtcttgatt
ccgaggaacacaacaattcccactaagaaggagcaaattttctcgacttattcagacaat
cagccaggagtgctgatccaggtgtatgaaggtgagagggctaaaaccaaggacaacaac
cttctcgggaaattcgagctaacgggcattcctcccgctccaagaggcgttcctcaaatc
aatgtgtgcttcgacattgatgccaatggtatactaaatgtgtcggccgaggacaagact
gccggagtaaagaacaagattaccatcaccaacgacaagggaaggttgagcaaggaagag
attgagagattggtgcaagaggcagagaagtacaaggcagaggacgaggaggtgaagaag
aaggtggaggctaggaactcgctcgagaattacgcatacaacatgagaaatactgtgaag
gacgagaagtttgctgggaaattgcatccaggggacaagcagaagatcgagaaggccatt
gacgagacgattgagtggctggacgggaaccaattggctgaagccgacgagtttgaggac
aagttgaaagagttggagggtttgtgcaatccaattgtcgcgaagatgtatcagggtgct
ggtggggacggacccatgggtggtggtgccgagccttcatctggtagttctggagccggg
cctaagatcgaagaggttgactga

DBGET integrated database retrieval system