KEGG   Juglans regia (English walnut): 108982820Help
Entry
108982820         CDS       T05245                                 

Definition
(RefSeq) probable L-type lectin-domain containing receptor kinase I.6
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
jre  Juglans regia (English walnut)
Brite
KEGG Orthology (KO) [BR:jre00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:jre01001]
    108982820
Enzymes [BR:jre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108982820
Protein kinases [BR:jre01001]
 Serine/threonine kinases: TKL group
  IRAK family
   108982820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_legB Pkinase_Tyr Pkinase Bact_lectin ETRAMP Sigma_reg_N Insulin_TMD
Motif
Other DBs
NCBI-GeneID: 108982820
NCBI-ProteinID: XP_018809823
UniProt: A0A2I4DRP8
Position
Unknown
AA seq 448 aa AA seqDB search
MATVLRSLHLLMILYISISPLNFAQDESQFIYNGFNQANLSLDGTAEILPNGLLQLTNSS
NQKLGHAFCQFPINFSTISSLSFSTNFVFAMVPREPELGGHGIAFAISPWRSFDATAAAY
LGLFDFSNNGLTSNHILAIELDSVESPEFEDIDNNHVGIDVNDLRSLVSAPATYYSNDER
RDISLELISGNAMQLWIDYDEVEKLLNVTLAPIRTPKPNWPLLSRPINLSEIVLESMYVG
FSASTGTLASDHYILGWSFNKSGQAQSLDISRLPTLPPRRKRKEKRIVVIRALLIVAVVL
LITITGAAYYFRRKKYEEVREDWESQYGTHRFSYKSLYKATKGFKAKEIIGEGGFGKVYR
GTLPSNEQIAVKRVSHDSQQGMKEFVAEIISMGRLRHRNLVRLLGYCRRKGELLLIYDYM
PHGSLDRFLYSNGRRHLNWLQRFQILKG
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggctacagttcttagatcacttcatcttctgatgattctctatatttccattagtccc
ttgaacttcgctcaagatgaaagccaattcatctacaatggcttcaatcaagccaatcta
tctcttgatggaaccgcagaaattctccctaatggtctattgcagctaaccaacagttcc
aaccagaaacttggtcatgctttttgccaatttcctataaatttcagcacgatttcgtct
ctttcattttctacaaactttgtgtttgccatggttcctcgagaaccagaactcggtgga
catggcatagccttcgccattagtccctggaggagctttgatgctacagcggctgcatac
ttgggactcttcgatttttcaaataatggccttacttccaaccacatattggccatcgag
cttgattctgttgagagtcctgaatttgaagatattgacaacaaccatgtgggaattgat
gtgaatgacctgagatcacttgtatcagctcctgcaacatattattccaatgacgaaagg
cgggatataagcttggagctcataagtgggaatgcaatgcaactttggatagactatgac
gaagtagaaaagttgttgaatgtaacactggccccaattagaaccccaaaaccaaactgg
cctctcttgtcgaggccgattaatctgtctgagatcgtgttggaatctatgtatgttggt
ttctctgcttccacaggtacacttgcaagtgaccattacattcttggatggagcttcaat
aaaagtgggcaagcacaaagcctcgacatttcgagactccctacacttcccccacgcagg
aaacgaaaagagaaaagaatagtagtgatccgagctcttctcatagtagcagtggttctg
ctgataacgataactggagctgcttactattttaggaggaagaaatacgaagaagtacgt
gaagattgggaaagtcagtatggtacacacaggttcagctataagagtctctacaaggca
accaaaggtttcaaagcaaaagagattattggagaaggaggttttggaaaggtttataga
ggaacacttccttctaatgagcaaattgcagtcaagagagtctcccatgattcccaacag
gggatgaaggaatttgtggctgagatcattagcatgggaagattgagacataggaacttg
gtgcggctcttgggctattgtcggcgcaagggagaactcctcttgatctatgattatatg
ccccatggaagccttgacaggttcttatacagcaatggaagaagacaccttaactggctt
caaagatttcaaatcctcaaagga

DBGET integrated database retrieval system