KEGG   Juglans regia (English walnut): 108983287Help
Entry
108983287         CDS       T05245                                 

Definition
(RefSeq) calcium-dependent protein kinase 26
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
jre  Juglans regia (English walnut)
Brite
KEGG Orthology (KO) [BR:jre00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:jre01001]
    108983287
Enzymes [BR:jre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     108983287
Protein kinases [BR:jre01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   108983287
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH YrbL-PhoP_reg Kinase-like Pkinase_fungal RIO1
Motif
Other DBs
NCBI-GeneID: 108983287
NCBI-ProteinID: XP_018810413
UniProt: A0A2I4DTE5
Position
Unknown
AA seq 518 aa AA seqDB search
MAVAKSNNGNGTLTQPCNCYKVESLTETILDANQTSNLKDRYILGEQLGWGQFGVIRVCS
DKLTGEVLACKSIAKERLFTLDDVRSVKLEIEIMTKLSGHPNVVDLKAVYEEEDYVHLVM
ELCAGGELFHLLEKHGRFSEAEARVRFRHLMQVVLYCHENGVVHRDLKPENILLATKAAS
SPIKLADFGLATYIKPGQSLRGLVGSPFYIAPEVLAGGYNQAADVWSAGVILYILLSAMP
PFWGKTKSRIFNAVRAADLRFPPEPWNHISESAKNLIGAMLCTDPSQRLTAQQVLEHPWM
KDNGPKEVNGWENKNCGERGVAGGSFSTSFMSRNQDVSFGTGSPIACEAESPTFTCRSSF
SSFLAEPSTPCPAAGGFSFCSNGDSNALEFSSPVPSMPSFAFFSPGSAIEQGSCALEFSA
SMSRVDPFQEEGSLGKLLLLSDSTLCLRHEANEMEHKEPEVRRVGGMIESRTLCTHGKRN
HTIGLGDREQLDLMVTESVIRWSSCTHLPTSLRSSLVC
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atggctgttgccaagagcaacaacggcaacggcacactcacacagccctgcaattgttat
aaagttgagagcttgactgaaaccattttggacgcaaatcagacctcaaatttgaaagat
cggtacattcttggggagcaattgggttgggggcagtttggtgtcatcagagtatgctct
gataagttaaccggagaggtattagcgtgcaaatcgattgctaaagagagattgtttaca
ttggatgatgtacgaagtgtgaagcttgagattgaaattatgaccaagctatctgggcac
ccaaatgttgtggatctcaaggcagtgtatgaggaggaagactatgttcatttggtgatg
gaactttgtgctggaggggagctatttcacctgctagaaaagcatgggcgattctccgaa
gctgaggccagggttcgcttcaggcatctgatgcaagtggttttgtattgtcatgaaaat
ggggtcgttcatagagatttgaagcctgagaatattctcctggccacaaaggccgcctct
tctccaattaaattggcagattttggtcttgcaacctacatcaagcctgggcagagcttg
cgtgggctagttgggagtccgttttatatagctccagaggtacttgctgggggctacaac
caggctgctgacgtttggagtgcaggtgttatcctttacattcttcttagtgcaatgcca
ccattttggggaaagacgaagtcccgtatattcaatgctgttagggcagctgatctgcgg
ttcccacctgaaccctggaatcacatatcagaatctgccaagaatctaattggtgcaatg
ctttgtactgatccttctcaaaggcttactgctcaacaggtcttagagcatccctggatg
aaggacaatggacctaaagaagtaaatgggtgggaaaataaaaattgtggagagaggggt
gtagctggtggctcgttctctacctcatttatgtccaggaatcaggacgtcagctttggc
actggatcacctattgcatgtgaggctgaatcacctacattcacatgcagatcatctttc
tcttctttcctagcggaaccgtcaacaccttgccctgcagctggtgggttttccttctgt
agcaatggcgattctaatgcgctggaattctcttcccctgttccctcaatgccaagtttt
gcattcttcagccctggttctgcaattgaacaagggagttgtgcattggagttttcagcc
agcatgtccagagtggatccattccaagaagagggaagcctgggcaagttgctcttgtta
tcagattctactctttgcttgaggcacgaggcaaacgaaatggaacacaaggaacctgaa
gttagaagggtaggaggaatgatcgagtctagaaccttatgcacccatggcaagaggaat
catacaattggacttggtgaccgcgagcaacttgatctcatggtgactgaatcagtcatc
cgttggtcatcatgcactcatcttcctacgtcccttaggtcttctctcgtatgttga

DBGET integrated database retrieval system