KEGG   Juglans regia (English walnut): 108983886Help
Entry
108983886         CDS       T05245                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
jre  Juglans regia (English walnut)
Pathway
jre00010  Glycolysis / Gluconeogenesis
jre00562  Inositol phosphate metabolism
jre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108983886
   00562 Inositol phosphate metabolism
    108983886
Enzymes [BR:jre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     108983886
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     108983886
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 108983886
NCBI-ProteinID: XP_018811216
UniProt: A0A2I4DVP2
Position
Unknown
AA seq 494 aa AA seqDB search
MERALFLLLLLLLSQLADSNAEEAFDVRKHLSTVTRYGFVKPTNNYFSPSNVPDGCIPIH
LNLVARHGTRSPTKKRIRELDNLEARLKVLTRDAEEQMLSLQKVPSWLREWKSPWKGKMK
GGELISKGEIELYDLGIRIRENFPDVFNEEYHPDVYAIRATQVPRASASAVAFGMGLLSG
KGSLGPGRHRAFAVTSESRASDILLRFYDTCENYKDFRKRQEPAVDKLKELILDEITSAL
VSRYGLNFTRQDTSSLWFLCKQEASLLDITDQACSLFSPSEVSLLEWADDLEVFILKGYG
NSLNYHMGVPLLEDVLQSMEQAIKAQEENLAHGSYEKARLRFAHAETVVPFTCLLGLFHD
GSGFQQIQREQPLELPPKPPQERNWRGSIVAPFGGNNMLVLYSCPANSSSKYLVQVLHNE
DPIPMPGCDGSDICPFKVFKEGIVAPHLKSDYHTVCSVKLTKAKQNPSITSRLAMLFRWL
FLGNDDKWSHKDDL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggagagggctctctttttgcttctcctccttcttttgtctcaattagctgattcaaat
gccgaagaagctttcgatgttcgaaaacatctttctaccgtgaccagatatggtttcgtg
aaacccaccaacaattacttttcgccttccaatgttcctgatggatgtattcccatccac
ttaaatcttgtggcaaggcatggaactcgttcccctactaagaaacggataagagagttg
gacaatttggaagctcgtctaaaagtacttacaagggatgcagaagaacagatgttgtct
ttgcaaaaggttccatcatggttaagagaatggaaatctccttggaaaggaaagatgaaa
ggtggagaattaattagcaaaggagagattgaactgtatgatcttggaatcaggattaga
gaaaattttccagatgtgtttaatgaggaataccacccggatgtatatgcaataagggca
actcaagttcctcgggcatccgctagtgctgtggcatttggaatgggactcctcagtggg
aaaggcagtcttggaccaggacgtcatcgagcatttgctgttactagtgaaagtcgtgca
agtgatatattgctaaggttttatgatacttgtgaaaactacaaggacttcaggaaaagg
caggagcctgctgttgataagcttaaggaacttatcttagatgaaatcacctctgcatta
gtaagtcgctacggactaaattttacaaggcaggatacttcttctctctggtttctgtgt
aaacaggaagcatcattgttggacattactgatcaagcttgtagtctcttcagcccatct
gaggtttctttgctggagtgggcagatgacttggaggtgtttatactgaagggttatggt
aattcattgaactatcacatgggagtgccactacttgaagatgttttgcaatccatggaa
caagctatcaaggcccaagaagaaaaccttgctcatggaagttatgagaaggcaagactt
cggttcgcacatgcagaaaccgtggttccattcacatgtctgcttggactttttcacgac
ggatctggatttcaacaaatacagagggagcaacccttggaactccctccaaagccaccc
caagagagaaattggaggggcagcattgtagcaccttttggtgggaataacatgctggtt
ctgtacagctgtccagctaactcttcaagcaagtacttagtgcaagtactgcacaatgaa
gaccccattccaatgccgggttgtgatggttctgatatctgtccgttcaaggtttttaag
gaaggaatagttgctcctcatcttaagagtgattatcatacagtctgcagtgtgaagctg
acaaaagcgaagcagaacccttctataaccagtaggttagcaatgctgttccgttggctc
tttctgggaaatgatgataaatggtctcacaaagatgatttgtag

DBGET integrated database retrieval system