KEGG   Juglans regia (English walnut): 108984792
Entry
108984792         CDS       T05245                                 

Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
jre  Juglans regia (English walnut)
Pathway
jre00100  Steroid biosynthesis
jre01100  Metabolic pathways
jre01110  Biosynthesis of secondary metabolites
Module
jre_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:jre00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    108984792
Enzymes [BR:jre01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     108984792
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 108984792
NCBI-ProteinID: XP_018812396
UniProt: A0A2I4DZ37
Position
3
AA seq 369 aa
MDLAFLLHALIPSWFSVAILATFFTYLAIVGSVLPGKVVSGVILQDGTRLHYRCNGLLSL
LVLVGLLGIGAKMNYISPTVISDRGLELLSTILAFSFLVTFVLYAAGCKSSNQGSSLKPH
LTESLIHDWWFGIQLNPQCMGIDLKFFFVRAGMMGWLLINLSVLARSIQDSTVSRSMILY
QLFCVLYILDYFVYEEYMTSTWDIIAERLGFMLVFGDLVWIPFTFSIQGWWLLSNKPELT
TAAVIANCFVFLMGYLVFRGANKQKHVFKKNPKALIWGKPPKVIGGKLLASGFWGVARHC
NYLGDLLLALSFSLPCGISSPIPYFYPVYLLILLIWRERRDEARCALKYKEVWAEYCRLV
PWRILPYFY
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggatctggcatttcttctccacgctctaattccctcgtggttctcagttgcgatctta
gccacgttttttacctacttggccattgttggatccgtactacccggaaaagttgtttcc
ggtgtgatcttacaggacggtacccgtcttcactatcgctgcaacggtttgttatcactt
cttgtgctggttgggcttctcgggatcggtgcaaagatgaattacatatcgcccactgtg
atatcagacagagggcttgagctgctatcaacaattttagcgttcagttttcttgtgacc
tttgtactttatgctgctggctgcaagtcaagcaatcagggttcttccctgaaacctcat
ctcacagagagcttaatacatgactggtggtttggaattcagctcaatcctcagtgtatg
ggcattgacctcaaatttttctttgttagagctggaatgatgggctggctactcatcaac
ctatcagttctagcgagaagcattcaagattccactgtgagccgatcaatgattctctac
cagctgttttgtgtgttatacatcctagactactttgtttatgaggaatacatgacctcc
acatgggacataattgctgaaaggttgggcttcatgttggtatttggagatctagtgtgg
atccctttcacttttagcattcagggctggtggcttttgagcaacaagccagagcttaca
acagcggctgtaatagccaattgctttgtttttctgatggggtatctcgtatttagagga
gctaacaagcaaaaacatgtatttaagaagaatcccaaagcacttatatggggcaagcct
ccaaaggtcattgggggaaagttgcttgcttccggtttctggggagttgcacggcactgt
aattaccttggggatctgttgcttgctctgtccttcagtttaccgtgtgggataagctcc
ccaattccatacttttatcccgtttatctgcttattctgctaatttggagagaaaggagg
gatgaagctcgctgtgccttgaagtacaaagaagtctgggcagaatactgtagacttgtt
ccatggagaatattgccttacttctattag

DBGET integrated database retrieval system